Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L6V103

Protein Details
Accession A0A0L6V103   
Localization Confidence Medium
Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
79-101ADAKTMSKRKRNKRVQPLFDRFAHydrophilic
NLS Segment(s)
PositionSequence
86-91KRKRNK
Subcellular Location(s) plas 11, nucl 6, golg 3, extr 2, E.R. 2, mito 1, pero 1, vacu 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR011709  DEAD-box_helicase_OB_fold  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF07717  OB_NTP_bind  
Amino Acid Sequences KDPQEGYKTLVEGTPVFIHPSSVLFNRAPEWFVDLSTTNLSFRSHHTFSLNCRLTYCRNVTAIEPKWLTEVAPTLFKIADAKTMSKRKRNKRVQPLFDRFAKVNNYLPFSLVYLVHLILLLVLFSSSFPAERKRLAYLKGQAQHPFQSNLWLIFSYSQDRNIPRPS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.17
3 0.19
4 0.18
5 0.18
6 0.16
7 0.17
8 0.17
9 0.16
10 0.19
11 0.17
12 0.19
13 0.2
14 0.21
15 0.2
16 0.16
17 0.19
18 0.16
19 0.15
20 0.16
21 0.15
22 0.16
23 0.17
24 0.17
25 0.13
26 0.14
27 0.15
28 0.14
29 0.17
30 0.23
31 0.23
32 0.24
33 0.26
34 0.28
35 0.32
36 0.41
37 0.4
38 0.32
39 0.32
40 0.33
41 0.34
42 0.38
43 0.37
44 0.29
45 0.28
46 0.29
47 0.29
48 0.34
49 0.33
50 0.32
51 0.28
52 0.25
53 0.24
54 0.24
55 0.22
56 0.14
57 0.14
58 0.1
59 0.11
60 0.11
61 0.11
62 0.11
63 0.11
64 0.11
65 0.09
66 0.12
67 0.12
68 0.14
69 0.21
70 0.29
71 0.34
72 0.4
73 0.5
74 0.55
75 0.65
76 0.74
77 0.77
78 0.8
79 0.86
80 0.87
81 0.89
82 0.86
83 0.79
84 0.72
85 0.64
86 0.53
87 0.46
88 0.4
89 0.32
90 0.3
91 0.29
92 0.29
93 0.26
94 0.27
95 0.23
96 0.21
97 0.2
98 0.13
99 0.12
100 0.09
101 0.09
102 0.08
103 0.07
104 0.06
105 0.05
106 0.05
107 0.04
108 0.03
109 0.03
110 0.03
111 0.03
112 0.04
113 0.04
114 0.06
115 0.08
116 0.13
117 0.16
118 0.19
119 0.22
120 0.27
121 0.31
122 0.33
123 0.4
124 0.42
125 0.48
126 0.51
127 0.53
128 0.52
129 0.51
130 0.53
131 0.49
132 0.46
133 0.37
134 0.38
135 0.35
136 0.32
137 0.3
138 0.25
139 0.22
140 0.2
141 0.22
142 0.22
143 0.22
144 0.25
145 0.29
146 0.33