Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L6USM4

Protein Details
Accession A0A0L6USM4    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
27-52QINSQVTVIRRKKKRNHIWTNDPLLQHydrophilic
NLS Segment(s)
PositionSequence
37-40RKKK
Subcellular Location(s) nucl 12.5, cyto_nucl 8.5, mito 8, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MSISPRTSSNKAYQQGHHPQAKNIQSQINSQVTVIRRKKKRNHIWTNDPLLQLIIDQISLGKGTENGNLKAEGWNQAHQNKIFGRLCVTFLGTIWHIPCLLGPITTPKREAMCADCHAVTSV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.64
3 0.67
4 0.67
5 0.6
6 0.57
7 0.6
8 0.61
9 0.57
10 0.5
11 0.47
12 0.4
13 0.41
14 0.44
15 0.38
16 0.32
17 0.28
18 0.29
19 0.27
20 0.35
21 0.4
22 0.42
23 0.48
24 0.57
25 0.67
26 0.74
27 0.82
28 0.83
29 0.86
30 0.86
31 0.88
32 0.86
33 0.83
34 0.76
35 0.65
36 0.53
37 0.42
38 0.33
39 0.23
40 0.15
41 0.08
42 0.04
43 0.04
44 0.03
45 0.03
46 0.04
47 0.04
48 0.03
49 0.04
50 0.05
51 0.1
52 0.13
53 0.13
54 0.14
55 0.15
56 0.15
57 0.16
58 0.16
59 0.19
60 0.18
61 0.19
62 0.22
63 0.25
64 0.28
65 0.26
66 0.3
67 0.24
68 0.31
69 0.29
70 0.26
71 0.27
72 0.24
73 0.25
74 0.22
75 0.23
76 0.14
77 0.13
78 0.16
79 0.13
80 0.13
81 0.12
82 0.12
83 0.11
84 0.11
85 0.11
86 0.11
87 0.11
88 0.09
89 0.1
90 0.19
91 0.25
92 0.27
93 0.28
94 0.28
95 0.3
96 0.32
97 0.35
98 0.29
99 0.3
100 0.31
101 0.34
102 0.31