Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L6VM63

Protein Details
Accession A0A0L6VM63   
Localization Confidence Low
Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
30-53KDGIKNERNQKPKKAQERAKGQEGBasic
NLS Segment(s)
PositionSequence
40-43KPKK
Subcellular Location(s) mito 17.5, mito_nucl 13.666, nucl 8.5, cyto_nucl 5.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR046798  2OG-FeII_Oxy_6  
Pfam View protein in Pfam  
PF20515  2OG-FeII_Oxy_6  
Amino Acid Sequences MAYTINPRPHTASPPTPPPLLLFQANFPEKDGIKNERNQKPKKAQERAKGQEGVKLSPHNIYSIIPWVDNKPTTTPLPRKLKKLILKFKPLNEDSIIAIIEFTSFEKLNPPEKDDLNLISTFLQDCKRFMRPVSSFSQVCGGLMWAIGWRG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.55
3 0.5
4 0.47
5 0.44
6 0.4
7 0.36
8 0.33
9 0.26
10 0.24
11 0.32
12 0.33
13 0.3
14 0.28
15 0.28
16 0.25
17 0.28
18 0.3
19 0.29
20 0.33
21 0.39
22 0.47
23 0.52
24 0.62
25 0.64
26 0.68
27 0.72
28 0.76
29 0.8
30 0.8
31 0.81
32 0.8
33 0.85
34 0.81
35 0.77
36 0.73
37 0.63
38 0.56
39 0.49
40 0.42
41 0.33
42 0.29
43 0.23
44 0.2
45 0.2
46 0.16
47 0.15
48 0.14
49 0.12
50 0.15
51 0.14
52 0.12
53 0.13
54 0.13
55 0.15
56 0.16
57 0.16
58 0.13
59 0.15
60 0.17
61 0.23
62 0.27
63 0.33
64 0.43
65 0.45
66 0.48
67 0.51
68 0.57
69 0.58
70 0.63
71 0.64
72 0.61
73 0.67
74 0.66
75 0.65
76 0.64
77 0.57
78 0.5
79 0.41
80 0.35
81 0.26
82 0.23
83 0.19
84 0.11
85 0.1
86 0.07
87 0.06
88 0.05
89 0.05
90 0.06
91 0.07
92 0.07
93 0.12
94 0.15
95 0.24
96 0.25
97 0.28
98 0.3
99 0.31
100 0.33
101 0.3
102 0.29
103 0.24
104 0.22
105 0.19
106 0.15
107 0.15
108 0.14
109 0.14
110 0.18
111 0.16
112 0.18
113 0.22
114 0.27
115 0.29
116 0.3
117 0.38
118 0.36
119 0.39
120 0.43
121 0.45
122 0.4
123 0.38
124 0.41
125 0.31
126 0.28
127 0.24
128 0.19
129 0.12
130 0.12
131 0.11