Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L6VB01

Protein Details
Accession A0A0L6VB01   
Localization Confidence Medium
Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
10-36HGKEITPKKVAKKKRTKVSQWYKDHSYHydrophilic
NLS Segment(s)
PositionSequence
16-25PKKVAKKKRT
Subcellular Location(s) nucl 13.5, mito_nucl 12.333, mito 9, cyto_nucl 8.666
Family & Domain DBs
Amino Acid Sequences MGLKCHLKDHGKEITPKKVAKKKRTKVSQWYKDHSYIDNIFSALNSIKFEFSRPCRVGNWISMPTAVDLVCNNFKPPVIFWLMILP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.6
3 0.62
4 0.65
5 0.65
6 0.7
7 0.72
8 0.77
9 0.78
10 0.82
11 0.87
12 0.86
13 0.88
14 0.89
15 0.89
16 0.85
17 0.82
18 0.76
19 0.7
20 0.63
21 0.53
22 0.46
23 0.37
24 0.31
25 0.25
26 0.2
27 0.16
28 0.14
29 0.13
30 0.09
31 0.08
32 0.07
33 0.07
34 0.08
35 0.08
36 0.1
37 0.15
38 0.19
39 0.28
40 0.28
41 0.3
42 0.3
43 0.35
44 0.35
45 0.34
46 0.36
47 0.28
48 0.28
49 0.26
50 0.25
51 0.21
52 0.2
53 0.15
54 0.1
55 0.08
56 0.13
57 0.17
58 0.17
59 0.18
60 0.17
61 0.19
62 0.2
63 0.21
64 0.21
65 0.23
66 0.22