Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L6UMZ4

Protein Details
Accession A0A0L6UMZ4    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
145-175ISKILPSRVKYPRQRKPQSHPSNKNKRQNQSHydrophilic
NLS Segment(s)
PositionSequence
159-160RK
Subcellular Location(s) nucl 15.5, mito_nucl 12.5, mito 8.5
Family & Domain DBs
Amino Acid Sequences QLQITSCPSTPPVHFFQFSQSNYKEWKGNVYAYCQEKTISQYLLSNKAATDAMAEQKEVWMQKEISTTTIICRYMGPNNQARFGVQNQSQVYHNFLKISFKTNLTKFLIACKISISNMQAVRMNIAVPKAKQTKFKKNHLAEITISKILPSRVKYPRQRKPQSHPSNKNKRQNQS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.33
3 0.38
4 0.42
5 0.42
6 0.44
7 0.4
8 0.38
9 0.41
10 0.43
11 0.39
12 0.32
13 0.36
14 0.32
15 0.37
16 0.35
17 0.37
18 0.4
19 0.4
20 0.4
21 0.34
22 0.31
23 0.27
24 0.29
25 0.27
26 0.21
27 0.18
28 0.22
29 0.24
30 0.3
31 0.29
32 0.25
33 0.22
34 0.22
35 0.21
36 0.17
37 0.15
38 0.11
39 0.14
40 0.14
41 0.14
42 0.13
43 0.13
44 0.16
45 0.15
46 0.14
47 0.13
48 0.13
49 0.15
50 0.18
51 0.18
52 0.17
53 0.17
54 0.16
55 0.14
56 0.18
57 0.16
58 0.14
59 0.14
60 0.15
61 0.18
62 0.22
63 0.24
64 0.27
65 0.28
66 0.29
67 0.28
68 0.27
69 0.24
70 0.22
71 0.23
72 0.17
73 0.22
74 0.2
75 0.22
76 0.23
77 0.21
78 0.23
79 0.2
80 0.19
81 0.15
82 0.15
83 0.18
84 0.17
85 0.22
86 0.19
87 0.21
88 0.26
89 0.26
90 0.32
91 0.3
92 0.31
93 0.26
94 0.29
95 0.31
96 0.26
97 0.25
98 0.21
99 0.19
100 0.18
101 0.2
102 0.16
103 0.17
104 0.17
105 0.18
106 0.2
107 0.19
108 0.19
109 0.17
110 0.16
111 0.12
112 0.14
113 0.16
114 0.14
115 0.22
116 0.28
117 0.31
118 0.41
119 0.48
120 0.57
121 0.62
122 0.72
123 0.74
124 0.71
125 0.78
126 0.72
127 0.67
128 0.59
129 0.56
130 0.5
131 0.4
132 0.35
133 0.26
134 0.24
135 0.24
136 0.27
137 0.25
138 0.3
139 0.37
140 0.48
141 0.58
142 0.67
143 0.74
144 0.8
145 0.87
146 0.87
147 0.89
148 0.9
149 0.91
150 0.91
151 0.92
152 0.92
153 0.93
154 0.94
155 0.94