Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L6V679

Protein Details
Accession A0A0L6V679   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
43-65GQYIKKFTPKKLKKYNKHFTDIHHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 21.5, cyto_mito 12.5, cyto 2.5
Family & Domain DBs
Amino Acid Sequences MRVAVAVTREQSSLMRVAALILWGGKMWAIGCRKSQEFPQIVGQYIKKFTPKKLKKYNKHFTDIHMSHQWDTEKNP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.12
3 0.11
4 0.11
5 0.1
6 0.09
7 0.07
8 0.05
9 0.05
10 0.05
11 0.05
12 0.04
13 0.04
14 0.04
15 0.09
16 0.11
17 0.13
18 0.16
19 0.2
20 0.21
21 0.22
22 0.24
23 0.27
24 0.26
25 0.26
26 0.3
27 0.28
28 0.28
29 0.29
30 0.28
31 0.22
32 0.22
33 0.22
34 0.22
35 0.24
36 0.3
37 0.4
38 0.47
39 0.56
40 0.65
41 0.75
42 0.78
43 0.87
44 0.9
45 0.86
46 0.84
47 0.75
48 0.69
49 0.7
50 0.6
51 0.56
52 0.52
53 0.47
54 0.41
55 0.45
56 0.42