Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0L6VTD3

Protein Details
Accession A0A0L6VTD3    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
43-62NDNRRGRRPRGKGGNKGPQKBasic
NLS Segment(s)
PositionSequence
46-60RRGRRPRGKGGNKGP
Subcellular Location(s) cyto_nucl 12.5, cyto 12, nucl 11, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR025715  FoP_C  
Gene Ontology GO:0003723  F:RNA binding  
Pfam View protein in Pfam  
PF13865  FoP_duplication  
Amino Acid Sequences MKVEIVVDPSRIPPAPLSTRVAPANKQTAPASAGAPNNQTATNDNRRGRRPRGKGGNKGPQKSAEELDAEVGCFVHPVLASDNDHRPCV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.26
3 0.29
4 0.33
5 0.31
6 0.35
7 0.38
8 0.39
9 0.34
10 0.34
11 0.37
12 0.33
13 0.33
14 0.3
15 0.27
16 0.26
17 0.24
18 0.21
19 0.17
20 0.18
21 0.17
22 0.17
23 0.16
24 0.16
25 0.15
26 0.14
27 0.13
28 0.18
29 0.24
30 0.3
31 0.33
32 0.37
33 0.44
34 0.5
35 0.57
36 0.61
37 0.6
38 0.63
39 0.7
40 0.74
41 0.77
42 0.8
43 0.81
44 0.78
45 0.74
46 0.67
47 0.61
48 0.55
49 0.49
50 0.4
51 0.32
52 0.26
53 0.23
54 0.23
55 0.18
56 0.15
57 0.12
58 0.11
59 0.08
60 0.07
61 0.07
62 0.06
63 0.06
64 0.07
65 0.11
66 0.14
67 0.18
68 0.22
69 0.31