Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L6VLX4

Protein Details
Accession A0A0L6VLX4    Localization Confidence Low Confidence Score 7.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-27SNAYPCTQSKPKNKTKHSRPKVMDAINHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 14, nucl 7, cyto 4
Family & Domain DBs
Amino Acid Sequences SNAYPCTQSKPKNKTKHSRPKVMDAINPTILKTTIEAIPVLTKDNFSSWKTRITALFKLGGVKDQILNGEPALDDSDNTIFNVVTATNEDNAIELWRAILKRLISSKPSNRARVYNQFANI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.89
3 0.91
4 0.9
5 0.91
6 0.85
7 0.84
8 0.83
9 0.76
10 0.7
11 0.64
12 0.6
13 0.54
14 0.49
15 0.4
16 0.32
17 0.28
18 0.23
19 0.18
20 0.15
21 0.11
22 0.12
23 0.11
24 0.11
25 0.12
26 0.12
27 0.14
28 0.11
29 0.1
30 0.1
31 0.12
32 0.15
33 0.15
34 0.2
35 0.19
36 0.24
37 0.24
38 0.26
39 0.28
40 0.29
41 0.3
42 0.27
43 0.28
44 0.23
45 0.23
46 0.22
47 0.19
48 0.14
49 0.12
50 0.11
51 0.09
52 0.1
53 0.08
54 0.09
55 0.07
56 0.07
57 0.06
58 0.06
59 0.07
60 0.06
61 0.06
62 0.07
63 0.08
64 0.08
65 0.08
66 0.08
67 0.07
68 0.07
69 0.07
70 0.06
71 0.05
72 0.07
73 0.08
74 0.08
75 0.09
76 0.09
77 0.08
78 0.09
79 0.09
80 0.08
81 0.06
82 0.07
83 0.1
84 0.1
85 0.11
86 0.15
87 0.14
88 0.19
89 0.25
90 0.29
91 0.32
92 0.42
93 0.49
94 0.55
95 0.63
96 0.65
97 0.64
98 0.67
99 0.69
100 0.7
101 0.7