Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0L6V8G6

Protein Details
Accession A0A0L6V8G6    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
12-31SRNYTRDRNPTKKPAPPRARHydrophilic
NLS Segment(s)
PositionSequence
24-26KPA
Subcellular Location(s) nucl 19.5, cyto_nucl 11.5, mito 5
Family & Domain DBs
Amino Acid Sequences MYSSICPIGAPSRNYTRDRNPTKKPAPPRARVLASPRSARPQGMVFSVDDLPQLLQSLQGAEQTSASRLPPPQSGDRRGMLFDVDNLPQELKNLQRDAPRNNTRQS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.52
3 0.55
4 0.6
5 0.67
6 0.7
7 0.7
8 0.74
9 0.78
10 0.8
11 0.8
12 0.8
13 0.8
14 0.78
15 0.76
16 0.73
17 0.69
18 0.64
19 0.61
20 0.58
21 0.53
22 0.5
23 0.45
24 0.43
25 0.41
26 0.37
27 0.33
28 0.27
29 0.23
30 0.21
31 0.2
32 0.14
33 0.15
34 0.15
35 0.13
36 0.1
37 0.09
38 0.08
39 0.07
40 0.07
41 0.04
42 0.04
43 0.04
44 0.05
45 0.05
46 0.06
47 0.07
48 0.06
49 0.07
50 0.08
51 0.09
52 0.09
53 0.09
54 0.1
55 0.11
56 0.14
57 0.16
58 0.21
59 0.29
60 0.34
61 0.39
62 0.41
63 0.41
64 0.4
65 0.37
66 0.33
67 0.26
68 0.2
69 0.18
70 0.17
71 0.15
72 0.15
73 0.15
74 0.16
75 0.14
76 0.15
77 0.16
78 0.18
79 0.24
80 0.25
81 0.28
82 0.35
83 0.42
84 0.48
85 0.56
86 0.6