Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L6VRR7

Protein Details
Accession A0A0L6VRR7   
Localization Confidence Medium
Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-25MVRNAGKFGKPKRGGKKQFTKDLAEHydrophilic
NLS Segment(s)
PositionSequence
7-17KFGKPKRGGKK
Subcellular Location(s) nucl 19.5, cyto_nucl 11.5, mito 4
Family & Domain DBs
Amino Acid Sequences MVRNAGKFGKPKRGGKKQFTKDLAESDRAGMWDGEESGTEEGSGSGTESLSGESSGEEEELATKLATSSLGDGGGGSSSTTAADPTQSRAERKAAKKLAAGKLQSKSTPADPQHDNSDPDDLAIGNTNRIPVKSVKLSQIDALDSGPLNRKESDGFGCQEARDTINDN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.84
3 0.88
4 0.87
5 0.88
6 0.83
7 0.79
8 0.71
9 0.69
10 0.63
11 0.56
12 0.47
13 0.38
14 0.35
15 0.28
16 0.26
17 0.18
18 0.14
19 0.11
20 0.11
21 0.09
22 0.08
23 0.1
24 0.09
25 0.09
26 0.08
27 0.07
28 0.06
29 0.07
30 0.06
31 0.05
32 0.05
33 0.05
34 0.05
35 0.05
36 0.06
37 0.06
38 0.06
39 0.05
40 0.05
41 0.06
42 0.06
43 0.05
44 0.05
45 0.04
46 0.05
47 0.05
48 0.06
49 0.05
50 0.05
51 0.05
52 0.05
53 0.05
54 0.05
55 0.05
56 0.05
57 0.05
58 0.05
59 0.05
60 0.05
61 0.05
62 0.04
63 0.03
64 0.03
65 0.03
66 0.03
67 0.04
68 0.04
69 0.04
70 0.06
71 0.06
72 0.09
73 0.14
74 0.15
75 0.17
76 0.18
77 0.24
78 0.3
79 0.33
80 0.4
81 0.39
82 0.39
83 0.42
84 0.47
85 0.49
86 0.46
87 0.46
88 0.41
89 0.41
90 0.41
91 0.38
92 0.32
93 0.28
94 0.25
95 0.3
96 0.27
97 0.29
98 0.29
99 0.31
100 0.36
101 0.37
102 0.35
103 0.29
104 0.3
105 0.24
106 0.21
107 0.19
108 0.13
109 0.1
110 0.13
111 0.12
112 0.11
113 0.11
114 0.14
115 0.14
116 0.15
117 0.17
118 0.15
119 0.21
120 0.27
121 0.3
122 0.34
123 0.36
124 0.38
125 0.38
126 0.37
127 0.31
128 0.25
129 0.22
130 0.17
131 0.14
132 0.15
133 0.2
134 0.2
135 0.22
136 0.22
137 0.23
138 0.23
139 0.27
140 0.3
141 0.27
142 0.28
143 0.28
144 0.29
145 0.28
146 0.29
147 0.27
148 0.24