Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L6V2G5

Protein Details
Accession A0A0L6V2G5   
Localization Confidence Medium
Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
38-66SLPTNLPWIQPKRRRDKKRKNHQHFVTTEHydrophilic
NLS Segment(s)
PositionSequence
48-57PKRRRDKKRK
Subcellular Location(s) mito 13, nucl 8.5, cyto_nucl 8, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MTTCPTARISRFFLPQTLHPGKSESRAIACSMASTSFSLPTNLPWIQPKRRRDKKRKNHQHFVTTENAENPYLIWTAIIGYYESNSIQSQSIVYQEFLALTYKNSVGTFLDKLDARLSSLAAVGLVVGNPEKADIKESLLAEYILAKISTDFASIKEILYQKCPLKALDGKHQETGAPYSAPPEIKQESSMKAQGTFSKSSSSK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.42
3 0.47
4 0.46
5 0.42
6 0.37
7 0.39
8 0.37
9 0.39
10 0.39
11 0.32
12 0.29
13 0.29
14 0.29
15 0.27
16 0.24
17 0.2
18 0.17
19 0.15
20 0.13
21 0.13
22 0.12
23 0.13
24 0.14
25 0.14
26 0.14
27 0.14
28 0.19
29 0.18
30 0.19
31 0.25
32 0.32
33 0.41
34 0.49
35 0.57
36 0.63
37 0.73
38 0.82
39 0.86
40 0.89
41 0.9
42 0.94
43 0.96
44 0.95
45 0.95
46 0.91
47 0.88
48 0.79
49 0.72
50 0.68
51 0.58
52 0.49
53 0.4
54 0.34
55 0.25
56 0.23
57 0.18
58 0.13
59 0.11
60 0.09
61 0.07
62 0.05
63 0.06
64 0.06
65 0.06
66 0.05
67 0.04
68 0.05
69 0.06
70 0.06
71 0.07
72 0.07
73 0.07
74 0.07
75 0.07
76 0.07
77 0.07
78 0.09
79 0.08
80 0.09
81 0.08
82 0.07
83 0.07
84 0.07
85 0.08
86 0.06
87 0.06
88 0.07
89 0.07
90 0.08
91 0.07
92 0.08
93 0.07
94 0.09
95 0.1
96 0.09
97 0.11
98 0.1
99 0.11
100 0.12
101 0.11
102 0.1
103 0.09
104 0.09
105 0.07
106 0.07
107 0.06
108 0.05
109 0.05
110 0.04
111 0.03
112 0.03
113 0.03
114 0.03
115 0.03
116 0.03
117 0.04
118 0.05
119 0.05
120 0.08
121 0.08
122 0.1
123 0.14
124 0.15
125 0.15
126 0.15
127 0.14
128 0.12
129 0.12
130 0.1
131 0.07
132 0.07
133 0.06
134 0.06
135 0.08
136 0.08
137 0.09
138 0.09
139 0.09
140 0.13
141 0.13
142 0.13
143 0.16
144 0.2
145 0.2
146 0.23
147 0.29
148 0.28
149 0.31
150 0.32
151 0.28
152 0.31
153 0.34
154 0.36
155 0.4
156 0.46
157 0.46
158 0.46
159 0.46
160 0.4
161 0.37
162 0.36
163 0.28
164 0.2
165 0.17
166 0.17
167 0.2
168 0.21
169 0.2
170 0.23
171 0.24
172 0.24
173 0.29
174 0.3
175 0.31
176 0.36
177 0.39
178 0.34
179 0.32
180 0.34
181 0.36
182 0.37
183 0.36
184 0.32