Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L6UU53

Protein Details
Accession A0A0L6UU53    Localization Confidence Low Confidence Score 6.4
NoLS Segment(s)
PositionSequenceProtein Nature
41-64LGVGKKCGKHSSRKKHPTQSAEGNHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 22, nucl 4, cyto_nucl 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR027417  P-loop_NTPase  
IPR038718  SNF2-like_sf  
IPR000330  SNF2_N  
Gene Ontology GO:0005524  F:ATP binding  
GO:0140658  F:ATP-dependent chromatin remodeler activity  
GO:0016787  F:hydrolase activity  
Pfam View protein in Pfam  
PF00176  SNF2-rel_dom  
Amino Acid Sequences TKRSGAILALKSHRKLCLTGTPLQNHLGKLYTLLRFLGVDLGVGKKCGKHSSRKKHPTQSAEGNQVASKTPGHSFIEEVKIRGSHITCEKRTNKLVDPRHFDIPQQATTWWDSPKIVHLVSDLNIHLASDQNGKTAKAVVLSQWTEFLNIVGVALRHEGIDFEQLDGGKGPFRNSQNCITEIIRYFIEGSIEVNMMEVC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.41
3 0.39
4 0.41
5 0.39
6 0.43
7 0.48
8 0.47
9 0.47
10 0.5
11 0.47
12 0.38
13 0.35
14 0.29
15 0.21
16 0.21
17 0.24
18 0.21
19 0.2
20 0.19
21 0.18
22 0.17
23 0.17
24 0.16
25 0.1
26 0.09
27 0.09
28 0.12
29 0.11
30 0.12
31 0.13
32 0.13
33 0.16
34 0.24
35 0.27
36 0.35
37 0.46
38 0.56
39 0.67
40 0.75
41 0.82
42 0.84
43 0.88
44 0.84
45 0.8
46 0.79
47 0.73
48 0.69
49 0.61
50 0.51
51 0.43
52 0.37
53 0.3
54 0.21
55 0.16
56 0.11
57 0.11
58 0.14
59 0.16
60 0.15
61 0.16
62 0.18
63 0.25
64 0.24
65 0.24
66 0.21
67 0.19
68 0.19
69 0.2
70 0.17
71 0.13
72 0.21
73 0.27
74 0.28
75 0.37
76 0.39
77 0.42
78 0.45
79 0.45
80 0.42
81 0.45
82 0.52
83 0.5
84 0.54
85 0.53
86 0.54
87 0.5
88 0.44
89 0.41
90 0.35
91 0.3
92 0.24
93 0.21
94 0.18
95 0.19
96 0.21
97 0.15
98 0.13
99 0.12
100 0.12
101 0.15
102 0.16
103 0.14
104 0.12
105 0.12
106 0.13
107 0.13
108 0.15
109 0.11
110 0.1
111 0.09
112 0.09
113 0.08
114 0.08
115 0.08
116 0.11
117 0.11
118 0.13
119 0.14
120 0.14
121 0.14
122 0.16
123 0.15
124 0.12
125 0.12
126 0.11
127 0.16
128 0.17
129 0.16
130 0.16
131 0.16
132 0.15
133 0.15
134 0.14
135 0.09
136 0.08
137 0.07
138 0.07
139 0.06
140 0.06
141 0.07
142 0.07
143 0.06
144 0.06
145 0.07
146 0.07
147 0.12
148 0.11
149 0.11
150 0.13
151 0.13
152 0.13
153 0.14
154 0.14
155 0.13
156 0.14
157 0.16
158 0.22
159 0.27
160 0.32
161 0.35
162 0.43
163 0.43
164 0.44
165 0.45
166 0.39
167 0.39
168 0.35
169 0.34
170 0.26
171 0.23
172 0.22
173 0.19
174 0.19
175 0.14
176 0.13
177 0.13
178 0.13
179 0.12