Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0L6VFW3

Protein Details
Accession A0A0L6VFW3    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MKRKNPPRHPKTYPTRKSSLKRSWBasic
NLS Segment(s)
Subcellular Location(s) mito 16, mito_nucl 13.999, nucl 9.5, cyto_nucl 7.166
Family & Domain DBs
Amino Acid Sequences MKRKNPPRHPKTYPTRKSSLKRSWVWNHLKVSSGPGFVICQVITKSGSICREKLWKDKSGSTKNLHRHLAQIYSLANLNLNKNTKTLHMDLSKGHQILSW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.81
3 0.8
4 0.8
5 0.8
6 0.79
7 0.77
8 0.73
9 0.75
10 0.75
11 0.76
12 0.76
13 0.72
14 0.67
15 0.58
16 0.55
17 0.46
18 0.43
19 0.35
20 0.27
21 0.21
22 0.17
23 0.16
24 0.14
25 0.15
26 0.09
27 0.08
28 0.08
29 0.09
30 0.09
31 0.09
32 0.09
33 0.11
34 0.16
35 0.17
36 0.17
37 0.18
38 0.24
39 0.26
40 0.34
41 0.35
42 0.37
43 0.38
44 0.44
45 0.51
46 0.53
47 0.56
48 0.53
49 0.57
50 0.58
51 0.61
52 0.58
53 0.49
54 0.45
55 0.42
56 0.39
57 0.32
58 0.26
59 0.2
60 0.18
61 0.18
62 0.15
63 0.15
64 0.14
65 0.16
66 0.2
67 0.23
68 0.22
69 0.23
70 0.24
71 0.25
72 0.29
73 0.29
74 0.31
75 0.31
76 0.32
77 0.34
78 0.39
79 0.42
80 0.37