Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L6V7M1

Protein Details
Accession A0A0L6V7M1   
Localization Confidence Medium
Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
42-72QKSCSPTTKGPRIKPRKKRAKTCHTTRPAEIHydrophilic
NLS Segment(s)
PositionSequence
50-62KGPRIKPRKKRAK
Subcellular Location(s) nucl 12, mito 11.5, cyto_nucl 8.833, cyto_mito 8.166
Family & Domain DBs
Amino Acid Sequences MPKAWAVCVENLLSRIKATKRTFEETGEAPDEDAIKIHVTPQKSCSPTTKGPRIKPRKKRAKTCHTTRPAEILETKDEETPNAPST
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.21
3 0.22
4 0.3
5 0.31
6 0.38
7 0.42
8 0.48
9 0.49
10 0.46
11 0.47
12 0.38
13 0.39
14 0.33
15 0.27
16 0.2
17 0.19
18 0.17
19 0.13
20 0.12
21 0.08
22 0.06
23 0.06
24 0.1
25 0.12
26 0.13
27 0.14
28 0.18
29 0.24
30 0.25
31 0.26
32 0.27
33 0.31
34 0.37
35 0.44
36 0.49
37 0.5
38 0.57
39 0.66
40 0.74
41 0.78
42 0.81
43 0.84
44 0.86
45 0.88
46 0.92
47 0.92
48 0.92
49 0.92
50 0.9
51 0.9
52 0.87
53 0.83
54 0.74
55 0.7
56 0.6
57 0.53
58 0.47
59 0.39
60 0.35
61 0.33
62 0.32
63 0.29
64 0.27
65 0.25
66 0.24