Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0L6V2H1

Protein Details
Accession A0A0L6V2H1    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MPRRRSCVFNKPRRKRNVRTGPSVTAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21.5, cyto_nucl 11.5, mito 4
Family & Domain DBs
Amino Acid Sequences MPRRRSCVFNKPRRKRNVRTGPSVTAQLIELDYLEEASRNVQYANEHRNDAPPSTCHDEDDYDNMEETCSAPPIQSCIPEDPPPTATGGKQLT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.92
2 0.9
3 0.9
4 0.91
5 0.86
6 0.85
7 0.81
8 0.75
9 0.67
10 0.6
11 0.49
12 0.38
13 0.31
14 0.22
15 0.16
16 0.11
17 0.08
18 0.06
19 0.06
20 0.05
21 0.05
22 0.04
23 0.04
24 0.06
25 0.06
26 0.06
27 0.06
28 0.06
29 0.09
30 0.14
31 0.19
32 0.2
33 0.21
34 0.21
35 0.24
36 0.25
37 0.24
38 0.2
39 0.16
40 0.19
41 0.25
42 0.25
43 0.22
44 0.22
45 0.23
46 0.23
47 0.25
48 0.23
49 0.17
50 0.17
51 0.16
52 0.14
53 0.13
54 0.12
55 0.1
56 0.09
57 0.08
58 0.08
59 0.09
60 0.13
61 0.14
62 0.16
63 0.18
64 0.22
65 0.27
66 0.31
67 0.33
68 0.32
69 0.32
70 0.29
71 0.3
72 0.26
73 0.22