Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L6UPP3

Protein Details
Accession A0A0L6UPP3   
Localization Confidence Low
Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
137-164LAAHVPTKKQSKRLQKSKNLRQEKMIKRHydrophilic
NLS Segment(s)
PositionSequence
147-155SKRLQKSKN
Subcellular Location(s) mito 20.5, mito_nucl 14, nucl 6.5
Family & Domain DBs
Amino Acid Sequences MDLAIQQLSLVRLHTNHPPNQIQKGTPVKVLIKFSLFIHQEQKIQEYLGFRNQKQILVEYRLNSFSDFQNWVAVACKTAFENTGSIITKNKFHVDSHSVSVNWLKKAVKTGKSDVNLTLTMPNPSEMIKQAEKEDLLAAHVPTKKQSKRLQKSKNLRQEKMIKRIWMMRNLKRWTGNASAPT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.31
3 0.35
4 0.41
5 0.48
6 0.51
7 0.57
8 0.58
9 0.49
10 0.51
11 0.55
12 0.5
13 0.45
14 0.44
15 0.41
16 0.42
17 0.44
18 0.38
19 0.31
20 0.3
21 0.28
22 0.32
23 0.29
24 0.27
25 0.28
26 0.28
27 0.3
28 0.3
29 0.31
30 0.23
31 0.22
32 0.22
33 0.2
34 0.21
35 0.26
36 0.31
37 0.28
38 0.36
39 0.37
40 0.37
41 0.35
42 0.36
43 0.31
44 0.32
45 0.34
46 0.27
47 0.28
48 0.27
49 0.27
50 0.24
51 0.21
52 0.15
53 0.16
54 0.17
55 0.15
56 0.15
57 0.14
58 0.13
59 0.13
60 0.12
61 0.1
62 0.08
63 0.08
64 0.07
65 0.08
66 0.09
67 0.08
68 0.08
69 0.08
70 0.11
71 0.11
72 0.11
73 0.14
74 0.14
75 0.15
76 0.16
77 0.18
78 0.16
79 0.16
80 0.2
81 0.22
82 0.23
83 0.22
84 0.23
85 0.2
86 0.2
87 0.24
88 0.23
89 0.18
90 0.19
91 0.17
92 0.17
93 0.25
94 0.31
95 0.33
96 0.35
97 0.39
98 0.42
99 0.44
100 0.44
101 0.38
102 0.34
103 0.27
104 0.24
105 0.22
106 0.16
107 0.15
108 0.14
109 0.14
110 0.11
111 0.12
112 0.12
113 0.12
114 0.16
115 0.17
116 0.18
117 0.19
118 0.21
119 0.2
120 0.19
121 0.18
122 0.13
123 0.13
124 0.14
125 0.12
126 0.15
127 0.18
128 0.17
129 0.22
130 0.31
131 0.33
132 0.41
133 0.5
134 0.56
135 0.65
136 0.75
137 0.8
138 0.82
139 0.89
140 0.91
141 0.92
142 0.91
143 0.83
144 0.81
145 0.81
146 0.79
147 0.78
148 0.74
149 0.66
150 0.61
151 0.67
152 0.64
153 0.64
154 0.64
155 0.63
156 0.67
157 0.69
158 0.71
159 0.67
160 0.63
161 0.59
162 0.56