Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L6USH1

Protein Details
Accession A0A0L6USH1   
Localization Confidence Medium
Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
81-106LNTWALYHKKRERETKRKADKEGIERBasic
NLS Segment(s)
PositionSequence
89-109KKRERETKRKADKEGIERAKK
Subcellular Location(s) nucl 11, mito 11, mito_nucl 11
Family & Domain DBs
Amino Acid Sequences MPTGSSVYILLTPGLPVDTRPQFASLGTQSTVFTESYQVFPDQLMSGMLSKKADRRFGSTLLVKESVKANKLPASIARFTLNTWALYHKKRERETKRKADKEGIERAKKEDEMMEVKHQA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.08
3 0.08
4 0.15
5 0.18
6 0.2
7 0.21
8 0.22
9 0.21
10 0.22
11 0.25
12 0.2
13 0.19
14 0.18
15 0.17
16 0.16
17 0.16
18 0.18
19 0.13
20 0.11
21 0.11
22 0.12
23 0.12
24 0.14
25 0.13
26 0.12
27 0.11
28 0.12
29 0.09
30 0.09
31 0.08
32 0.07
33 0.08
34 0.08
35 0.09
36 0.09
37 0.1
38 0.15
39 0.19
40 0.25
41 0.24
42 0.3
43 0.32
44 0.32
45 0.36
46 0.33
47 0.31
48 0.27
49 0.28
50 0.21
51 0.2
52 0.22
53 0.2
54 0.18
55 0.18
56 0.18
57 0.18
58 0.19
59 0.19
60 0.19
61 0.22
62 0.22
63 0.22
64 0.22
65 0.19
66 0.19
67 0.23
68 0.21
69 0.16
70 0.16
71 0.21
72 0.24
73 0.28
74 0.37
75 0.38
76 0.45
77 0.52
78 0.62
79 0.67
80 0.73
81 0.8
82 0.82
83 0.87
84 0.86
85 0.85
86 0.83
87 0.8
88 0.77
89 0.77
90 0.76
91 0.73
92 0.67
93 0.65
94 0.61
95 0.53
96 0.47
97 0.39
98 0.35
99 0.32
100 0.34