Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L6UB18

Protein Details
Accession A0A0L6UB18   
Localization Confidence Medium
Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-36MPKKATPKPMKPTTKKPAIQRKSKKNRGKHSYEDDGBasic
NLS Segment(s)
PositionSequence
3-29KKATPKPMKPTTKKPAIQRKSKKNRGK
Subcellular Location(s) mito 11.5, mito_nucl 11.333, nucl 10, cyto_nucl 7.333, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MPKKATPKPMKPTTKKPAIQRKSKKNRGKHSYEDDGADKKAIQLKKEDYLVIIEWLKIEWNYNSCFGTGKAPSVGLPAKDKYNKFHTKYISTGFGLTNEDLNTGISKIDEKLESMCTHYHVMNDLMGADNKTETSSF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.83
3 0.83
4 0.84
5 0.82
6 0.85
7 0.85
8 0.86
9 0.87
10 0.92
11 0.9
12 0.89
13 0.91
14 0.89
15 0.87
16 0.84
17 0.81
18 0.79
19 0.71
20 0.64
21 0.56
22 0.49
23 0.42
24 0.33
25 0.25
26 0.19
27 0.24
28 0.22
29 0.2
30 0.24
31 0.27
32 0.3
33 0.31
34 0.29
35 0.23
36 0.23
37 0.22
38 0.18
39 0.15
40 0.11
41 0.1
42 0.1
43 0.1
44 0.08
45 0.09
46 0.07
47 0.09
48 0.11
49 0.12
50 0.13
51 0.12
52 0.13
53 0.12
54 0.15
55 0.13
56 0.12
57 0.11
58 0.11
59 0.1
60 0.12
61 0.13
62 0.11
63 0.13
64 0.14
65 0.19
66 0.24
67 0.25
68 0.27
69 0.36
70 0.43
71 0.44
72 0.49
73 0.49
74 0.47
75 0.49
76 0.48
77 0.42
78 0.33
79 0.31
80 0.25
81 0.21
82 0.2
83 0.17
84 0.16
85 0.12
86 0.12
87 0.1
88 0.1
89 0.1
90 0.08
91 0.08
92 0.07
93 0.08
94 0.08
95 0.11
96 0.11
97 0.11
98 0.13
99 0.16
100 0.17
101 0.18
102 0.18
103 0.18
104 0.2
105 0.2
106 0.19
107 0.18
108 0.19
109 0.16
110 0.16
111 0.13
112 0.14
113 0.14
114 0.14
115 0.12
116 0.12
117 0.12