Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L6UR16

Protein Details
Accession A0A0L6UR16    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MTRRKGERNKKKGRVENSTTDTHydrophilic
NLS Segment(s)
PositionSequence
3-14RRKGERNKKKGR
Subcellular Location(s) mito 23, cyto 2.5, cyto_nucl 2.5
Family & Domain DBs
Amino Acid Sequences MTRRKGERNKKKGRVENSTTDTIIKLISFPSLDQPDKWCETMPSFERWQGIPRIVGVIIGTHIHILMPPDGNWKLYVNRKSWASIVFQCVVDGDGNFCDVQVFRCSPLGQSLQNNK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.88
2 0.84
3 0.82
4 0.77
5 0.71
6 0.61
7 0.52
8 0.43
9 0.33
10 0.26
11 0.17
12 0.11
13 0.08
14 0.09
15 0.08
16 0.08
17 0.14
18 0.19
19 0.2
20 0.21
21 0.24
22 0.27
23 0.29
24 0.29
25 0.23
26 0.2
27 0.21
28 0.26
29 0.25
30 0.24
31 0.24
32 0.25
33 0.26
34 0.24
35 0.26
36 0.22
37 0.21
38 0.17
39 0.15
40 0.15
41 0.13
42 0.12
43 0.09
44 0.06
45 0.05
46 0.05
47 0.05
48 0.04
49 0.04
50 0.04
51 0.04
52 0.05
53 0.06
54 0.06
55 0.07
56 0.11
57 0.12
58 0.13
59 0.14
60 0.14
61 0.18
62 0.26
63 0.31
64 0.29
65 0.32
66 0.33
67 0.34
68 0.34
69 0.31
70 0.28
71 0.26
72 0.28
73 0.26
74 0.25
75 0.23
76 0.21
77 0.2
78 0.16
79 0.13
80 0.1
81 0.08
82 0.09
83 0.09
84 0.09
85 0.09
86 0.08
87 0.11
88 0.15
89 0.16
90 0.16
91 0.2
92 0.21
93 0.21
94 0.27
95 0.29
96 0.28