Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0L6U772

Protein Details
Accession A0A0L6U772    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
44-66QIFGRYIKQFRRKTKRLKVEATIHydrophilic
NLS Segment(s)
PositionSequence
53-72FRRKTKRLKVEATIARKKGR
Subcellular Location(s) nucl 12.5, mito 9.5, cyto_nucl 8.833, cyto_mito 7.333, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR046798  2OG-FeII_Oxy_6  
Pfam View protein in Pfam  
PF20515  2OG-FeII_Oxy_6  
Amino Acid Sequences DDLNFLSTFLHNSKRFISPVSSCSQVWGGLMWAIGWRRSYDKDQIFGRYIKQFRRKTKRLKVEATIARKKGRTT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.32
3 0.31
4 0.33
5 0.28
6 0.3
7 0.3
8 0.3
9 0.26
10 0.27
11 0.25
12 0.2
13 0.17
14 0.13
15 0.1
16 0.08
17 0.08
18 0.06
19 0.07
20 0.07
21 0.08
22 0.08
23 0.09
24 0.11
25 0.14
26 0.17
27 0.23
28 0.25
29 0.29
30 0.3
31 0.33
32 0.34
33 0.32
34 0.33
35 0.33
36 0.35
37 0.39
38 0.47
39 0.52
40 0.6
41 0.7
42 0.75
43 0.78
44 0.85
45 0.87
46 0.86
47 0.85
48 0.8
49 0.79
50 0.79
51 0.78
52 0.76
53 0.71
54 0.68