Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0L6VMN8

Protein Details
Accession A0A0L6VMN8    Localization Confidence Low Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
81-104NETPDRTRPKQKDLTSKNCRPNSIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18.5, cyto_nucl 13, cyto 4.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR012337  RNaseH-like_sf  
IPR002156  RNaseH_domain  
IPR036397  RNaseH_sf  
Gene Ontology GO:0003676  F:nucleic acid binding  
GO:0004523  F:RNA-DNA hybrid ribonuclease activity  
PROSITE View protein in PROSITE  
PS50879  RNASE_H_1  
Amino Acid Sequences MTQDHRPFVKAFILTDNKGVIQQLSDPKIEKSLQYLFLEILEALSSLPRDIDLNIVWCPEHQGIIGNKAVDLLAGEATDRNETPDRTRPKQKDLTSKNCRPNSIMI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.33
3 0.32
4 0.26
5 0.25
6 0.24
7 0.16
8 0.11
9 0.15
10 0.19
11 0.21
12 0.22
13 0.23
14 0.23
15 0.26
16 0.26
17 0.22
18 0.2
19 0.21
20 0.24
21 0.23
22 0.23
23 0.2
24 0.19
25 0.19
26 0.14
27 0.1
28 0.06
29 0.05
30 0.04
31 0.04
32 0.04
33 0.04
34 0.04
35 0.04
36 0.04
37 0.04
38 0.06
39 0.06
40 0.08
41 0.08
42 0.08
43 0.08
44 0.08
45 0.11
46 0.09
47 0.09
48 0.07
49 0.12
50 0.13
51 0.16
52 0.17
53 0.14
54 0.14
55 0.14
56 0.13
57 0.08
58 0.08
59 0.05
60 0.04
61 0.04
62 0.05
63 0.05
64 0.06
65 0.08
66 0.08
67 0.12
68 0.14
69 0.16
70 0.22
71 0.3
72 0.38
73 0.44
74 0.55
75 0.56
76 0.63
77 0.71
78 0.73
79 0.76
80 0.77
81 0.81
82 0.81
83 0.84
84 0.85
85 0.81
86 0.76