Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L6UEH1

Protein Details
Accession A0A0L6UEH1   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MCDLSQRTRRTPKMSGRQQRVMVHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 24, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR010920  LSM_dom_sf  
IPR001163  Sm_dom_euk/arc  
IPR027078  snRNP-E  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005681  C:spliceosomal complex  
GO:0005685  C:U1 snRNP  
GO:0005686  C:U2 snRNP  
GO:0005687  C:U4 snRNP  
GO:0046540  C:U4/U6 x U5 tri-snRNP complex  
GO:0005682  C:U5 snRNP  
GO:0003723  F:RNA binding  
GO:0006364  P:rRNA processing  
GO:0000387  P:spliceosomal snRNP assembly  
Pfam View protein in Pfam  
PF01423  LSM  
CDD cd01718  Sm_E  
Amino Acid Sequences MCDLSQRTRRTPKMSGRQQRVMVQPINVIFKHLQAGQLVHIWLYDNTEFRLEGKIIGFDEFMNVVLDNASEVWVKSKKGTPHREAVEKGARVSLGDVMNQVEITLKIL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.82
3 0.8
4 0.81
5 0.78
6 0.76
7 0.71
8 0.66
9 0.57
10 0.48
11 0.42
12 0.36
13 0.36
14 0.29
15 0.27
16 0.21
17 0.19
18 0.2
19 0.18
20 0.17
21 0.14
22 0.15
23 0.13
24 0.14
25 0.13
26 0.11
27 0.1
28 0.09
29 0.08
30 0.1
31 0.1
32 0.09
33 0.1
34 0.11
35 0.11
36 0.1
37 0.12
38 0.09
39 0.09
40 0.09
41 0.09
42 0.09
43 0.09
44 0.09
45 0.07
46 0.07
47 0.06
48 0.06
49 0.06
50 0.05
51 0.05
52 0.05
53 0.05
54 0.04
55 0.04
56 0.05
57 0.05
58 0.05
59 0.09
60 0.12
61 0.13
62 0.15
63 0.21
64 0.28
65 0.38
66 0.47
67 0.48
68 0.55
69 0.59
70 0.63
71 0.6
72 0.59
73 0.58
74 0.5
75 0.45
76 0.38
77 0.33
78 0.27
79 0.26
80 0.23
81 0.16
82 0.15
83 0.15
84 0.14
85 0.15
86 0.14
87 0.13
88 0.1