Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0L6VIF4

Protein Details
Accession A0A0L6VIF4    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-20APQKKKKKQEEEAPKKKFFPBasic
NLS Segment(s)
PositionSequence
4-17KKKKKQEEEAPKKK
Subcellular Location(s) nucl 16.5, cyto_nucl 12.5, cyto 5.5, mito 3
Family & Domain DBs
Amino Acid Sequences APQKKKKKQEEEAPKKKFFPIQAVRIPHQKPPPHDPKYLLLLPEILQPYISKVLDVESDGHCSFRVVSYCLDLDNMNILPCGTNSINTPRKEVNGIRIFLILIISPLS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.76
3 0.69
4 0.63
5 0.55
6 0.54
7 0.52
8 0.51
9 0.54
10 0.57
11 0.57
12 0.6
13 0.58
14 0.55
15 0.54
16 0.52
17 0.5
18 0.54
19 0.61
20 0.58
21 0.6
22 0.56
23 0.52
24 0.53
25 0.49
26 0.39
27 0.29
28 0.25
29 0.22
30 0.23
31 0.2
32 0.13
33 0.11
34 0.11
35 0.12
36 0.14
37 0.14
38 0.09
39 0.08
40 0.09
41 0.09
42 0.1
43 0.1
44 0.08
45 0.12
46 0.12
47 0.12
48 0.11
49 0.11
50 0.11
51 0.11
52 0.12
53 0.1
54 0.1
55 0.12
56 0.12
57 0.12
58 0.13
59 0.11
60 0.1
61 0.1
62 0.1
63 0.08
64 0.08
65 0.08
66 0.08
67 0.08
68 0.12
69 0.1
70 0.11
71 0.13
72 0.23
73 0.3
74 0.31
75 0.36
76 0.33
77 0.35
78 0.41
79 0.41
80 0.42
81 0.42
82 0.42
83 0.38
84 0.37
85 0.34
86 0.28
87 0.26
88 0.15