Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0L6V5Q6

Protein Details
Accession A0A0L6V5Q6    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
21-46ISHKNLSKRLTKERNKQKRKAEEHADBasic
NLS Segment(s)
PositionSequence
27-40SKRLTKERNKQKRK
Subcellular Location(s) mito 13, nucl 8.5, cyto_nucl 7.5, cyto 5.5
Family & Domain DBs
Amino Acid Sequences MTAGYVDVGTLNIVSVTHGRISHKNLSKRLTKERNKQKRKAEEHADIQQNVVGLNDTTNTIKTSIHWQRAYLSYNYRELLK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.07
3 0.08
4 0.1
5 0.12
6 0.15
7 0.2
8 0.26
9 0.34
10 0.4
11 0.46
12 0.49
13 0.53
14 0.57
15 0.59
16 0.64
17 0.65
18 0.67
19 0.7
20 0.76
21 0.82
22 0.84
23 0.86
24 0.85
25 0.85
26 0.83
27 0.8
28 0.76
29 0.71
30 0.66
31 0.65
32 0.6
33 0.49
34 0.42
35 0.34
36 0.27
37 0.21
38 0.16
39 0.09
40 0.05
41 0.05
42 0.06
43 0.06
44 0.07
45 0.08
46 0.09
47 0.09
48 0.1
49 0.11
50 0.21
51 0.28
52 0.36
53 0.36
54 0.36
55 0.4
56 0.45
57 0.48
58 0.42
59 0.41
60 0.36
61 0.39