Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0L6VIH7

Protein Details
Accession A0A0L6VIH7    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
2-30NLEPNPKRKTGKPERKKRRNRTISCLSLPHydrophilic
NLS Segment(s)
PositionSequence
7-22PKRKTGKPERKKRRNR
Subcellular Location(s) nucl 18, cyto_nucl 12.5, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR036397  RNaseH_sf  
Gene Ontology GO:0003676  F:nucleic acid binding  
Amino Acid Sequences MNLEPNPKRKTGKPERKKRRNRTISCLSLPYGLNLKDNFECRACVLAKITKQPFKAQSTLASKPFKSLHLDLIGPINPGSSSKNRFILTVMDNHSGYLASFPLYSLVSLRRTARLVSFFLNPQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.86
3 0.91
4 0.96
5 0.96
6 0.96
7 0.95
8 0.92
9 0.9
10 0.89
11 0.85
12 0.78
13 0.7
14 0.6
15 0.52
16 0.45
17 0.37
18 0.31
19 0.24
20 0.23
21 0.21
22 0.23
23 0.22
24 0.23
25 0.24
26 0.2
27 0.2
28 0.17
29 0.21
30 0.18
31 0.16
32 0.17
33 0.19
34 0.21
35 0.28
36 0.32
37 0.33
38 0.34
39 0.38
40 0.41
41 0.4
42 0.4
43 0.33
44 0.35
45 0.36
46 0.38
47 0.39
48 0.36
49 0.32
50 0.33
51 0.33
52 0.28
53 0.27
54 0.25
55 0.22
56 0.22
57 0.22
58 0.19
59 0.2
60 0.19
61 0.15
62 0.13
63 0.1
64 0.08
65 0.09
66 0.12
67 0.15
68 0.19
69 0.22
70 0.27
71 0.27
72 0.27
73 0.28
74 0.29
75 0.25
76 0.27
77 0.28
78 0.26
79 0.26
80 0.26
81 0.25
82 0.2
83 0.18
84 0.13
85 0.09
86 0.06
87 0.06
88 0.06
89 0.08
90 0.08
91 0.08
92 0.09
93 0.13
94 0.15
95 0.19
96 0.21
97 0.23
98 0.25
99 0.27
100 0.3
101 0.3
102 0.3
103 0.3