Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0L6VDG7

Protein Details
Accession A0A0L6VDG7    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
92-115PCTTEVRRQGKDNRNKRQKVRKERBasic
NLS Segment(s)
PositionSequence
100-115QGKDNRNKRQKVRKER
Subcellular Location(s) nucl 16, cyto_nucl 11.5, cyto 5, mito 4
Family & Domain DBs
Amino Acid Sequences MDLGRDILINIVTVSKNCLIIDVLPLVEQPLANAYASRFSGISEILTMLILFLDLPKLFNTTTSQLKLITYIGSPFFLITHVVMCMTVHKDPCTTEVRRQGKDNRNKRQKVRKER
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.14
3 0.15
4 0.14
5 0.15
6 0.14
7 0.14
8 0.16
9 0.13
10 0.12
11 0.1
12 0.1
13 0.1
14 0.09
15 0.08
16 0.06
17 0.07
18 0.08
19 0.07
20 0.08
21 0.08
22 0.1
23 0.1
24 0.11
25 0.09
26 0.09
27 0.09
28 0.09
29 0.09
30 0.07
31 0.07
32 0.06
33 0.06
34 0.05
35 0.04
36 0.04
37 0.03
38 0.03
39 0.02
40 0.04
41 0.04
42 0.04
43 0.05
44 0.06
45 0.06
46 0.08
47 0.1
48 0.12
49 0.16
50 0.16
51 0.17
52 0.16
53 0.16
54 0.16
55 0.14
56 0.11
57 0.08
58 0.09
59 0.09
60 0.09
61 0.09
62 0.08
63 0.07
64 0.07
65 0.08
66 0.06
67 0.07
68 0.06
69 0.06
70 0.06
71 0.06
72 0.08
73 0.11
74 0.14
75 0.15
76 0.16
77 0.17
78 0.18
79 0.22
80 0.26
81 0.27
82 0.32
83 0.41
84 0.48
85 0.5
86 0.57
87 0.63
88 0.67
89 0.74
90 0.76
91 0.77
92 0.81
93 0.86
94 0.9
95 0.91