Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L6UMJ7

Protein Details
Accession A0A0L6UMJ7   
Localization Confidence Low
Confidence Score 9.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-29MIVFVGVERRKKKKTKGKPHDKSNFSRLIHydrophilic
NLS Segment(s)
PositionSequence
9-20RRKKKKTKGKPH
Subcellular Location(s) mito 16.5, mito_nucl 11.833, nucl 6, cyto_nucl 5.833, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MIVFVGVERRKKKKTKGKPHDKSNFSRLIIFPFSAHTTFHKSNKEWYFETDYPKHNHPASEDPQAHVGNCRLTSAHYPKVKNLPQALKPAKIL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.84
3 0.88
4 0.91
5 0.92
6 0.94
7 0.94
8 0.9
9 0.85
10 0.81
11 0.77
12 0.66
13 0.6
14 0.49
15 0.44
16 0.39
17 0.32
18 0.25
19 0.2
20 0.21
21 0.18
22 0.18
23 0.15
24 0.21
25 0.24
26 0.29
27 0.31
28 0.3
29 0.38
30 0.41
31 0.43
32 0.37
33 0.37
34 0.4
35 0.37
36 0.42
37 0.37
38 0.38
39 0.37
40 0.38
41 0.39
42 0.32
43 0.31
44 0.28
45 0.31
46 0.31
47 0.37
48 0.36
49 0.32
50 0.35
51 0.35
52 0.32
53 0.27
54 0.25
55 0.2
56 0.19
57 0.19
58 0.14
59 0.17
60 0.25
61 0.29
62 0.36
63 0.39
64 0.4
65 0.46
66 0.55
67 0.58
68 0.57
69 0.59
70 0.59
71 0.58
72 0.67
73 0.66