Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L6V2V1

Protein Details
Accession A0A0L6V2V1    Localization Confidence Low Confidence Score 8.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MFNPRSPSCKRKRRIKNCSSNGKGPTHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15.5, mito_nucl 14.333, mito 11, cyto_nucl 8.666
Family & Domain DBs
Amino Acid Sequences MFNPRSPSCKRKRRIKNCSSNGKGPTWKSGMEHDNDIQAQSNFYLTQGFFHKLRNTAAQIWVVNYKPCGINHWMSMPNTVHLLVETYNRPVFYFSSYLSQSFFHYSTGPNNNQPIFLARHFVELNMEDEIL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.92
2 0.92
3 0.93
4 0.92
5 0.94
6 0.9
7 0.86
8 0.79
9 0.74
10 0.69
11 0.6
12 0.57
13 0.48
14 0.42
15 0.36
16 0.39
17 0.37
18 0.33
19 0.35
20 0.29
21 0.29
22 0.28
23 0.27
24 0.23
25 0.18
26 0.16
27 0.12
28 0.12
29 0.09
30 0.09
31 0.1
32 0.08
33 0.1
34 0.12
35 0.15
36 0.14
37 0.18
38 0.21
39 0.21
40 0.23
41 0.24
42 0.24
43 0.23
44 0.24
45 0.23
46 0.2
47 0.19
48 0.2
49 0.17
50 0.14
51 0.13
52 0.12
53 0.12
54 0.12
55 0.14
56 0.15
57 0.16
58 0.17
59 0.2
60 0.22
61 0.2
62 0.24
63 0.21
64 0.18
65 0.17
66 0.16
67 0.12
68 0.09
69 0.1
70 0.07
71 0.1
72 0.1
73 0.13
74 0.14
75 0.14
76 0.14
77 0.15
78 0.15
79 0.15
80 0.16
81 0.14
82 0.18
83 0.19
84 0.19
85 0.19
86 0.19
87 0.18
88 0.19
89 0.19
90 0.15
91 0.15
92 0.16
93 0.23
94 0.3
95 0.32
96 0.33
97 0.38
98 0.38
99 0.37
100 0.36
101 0.32
102 0.3
103 0.27
104 0.27
105 0.22
106 0.27
107 0.26
108 0.26
109 0.26
110 0.22
111 0.23