FuNGI

A0A0L6UFL5

Protein Details

Accession

A0A0L6UFL5

Localization Confidence

Medium

Confidence Score

10.4

NoLS Segment(s)

Position	Sequence	Protein Nature
38-61	TSLALARRTRERNRAKPPIHPSVP	Hydrophilic

NLS Segment(s)

Subcellular Location(s)

nucl 14, mito 12

Family & Domain DBs

InterPro	View protein in InterPro IPR038340 MRP-L47_sf IPR010729 Ribosomal_L47_mit
Gene Ontology	GO:0005761 C:mitochondrial ribosome GO:1990904 C:ribonucleoprotein complex GO:0003735 F:structural constituent of ribosome GO:0006412 P:translation
Pfam	View protein in Pfam PF06984 MRP-L47

Amino Acid Sequences

MFVATKLGAASSSWTTMYPCRSHLRLPTELNRSSFHSTSLALARRTRERNRAKPPIHPSVPSFKLSPNEPSHLASSRRKLMGIKSQKNLDEFAWKHDSSQNVLRRKDGVTGKYVHAKIDWIADPKRKFLKAKQEEKILRQDDEYVEKRKKDFEMPIEEANNLDPTLSSDPPRQMWKLPVQELNRGAPSLVHEYGREEYQLYTHEQRKAFSDIRARAFEHEKKRLDILSQGPHASPDLADQDFWDYEKNLRSPLYDFFRGGQIIEECSVSDARYSHWSVAQLRRKSFNDLQVLWFVLLKERNILHVQRTEARRIFGRLVDPSNPGEPLSTIRRQLKAVQYSLRNIKVTVSERRKAIDMRRQFLQKYQSKRAQTAEFQQWIIELEIQKEKMVRDTKPGLDMEAVESYFKTPDGRDRILRSLKARGLSQFQLKQNLAAFDRFVQNSGSESLLSPSATPAILHDSPSQTLETTQ

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.14
2	0.17
3	0.21
4	0.28
5	0.27
6	0.3
7	0.35
8	0.38
9	0.43
10	0.49
11	0.51
12	0.52
13	0.57
14	0.61
15	0.62
16	0.64
17	0.6
18	0.54
19	0.53
20	0.52
21	0.45
22	0.38
23	0.31
24	0.28
25	0.29
26	0.34
27	0.34
28	0.31
29	0.34
30	0.38
31	0.45
32	0.53
33	0.57
34	0.6
35	0.66
36	0.72
37	0.79
38	0.85
39	0.79
40	0.8
41	0.81
42	0.8
43	0.74
44	0.67
45	0.61
46	0.6
47	0.6
48	0.53
49	0.46
50	0.39
51	0.39
52	0.39
53	0.43
54	0.38
55	0.39
56	0.39
57	0.4
58	0.39
59	0.41
60	0.45
61	0.43
62	0.45
63	0.48
64	0.47
65	0.46
66	0.45
67	0.46
68	0.51
69	0.54
70	0.55
71	0.54
72	0.59
73	0.6
74	0.58
75	0.54
76	0.44
77	0.43
78	0.36
79	0.37
80	0.37
81	0.34
82	0.35
83	0.36
84	0.37
85	0.32
86	0.4
87	0.41
88	0.42
89	0.43
90	0.43
91	0.43
92	0.42
93	0.45
94	0.43
95	0.38
96	0.35
97	0.37
98	0.38
99	0.44
100	0.43
101	0.36
102	0.3
103	0.28
104	0.24
105	0.26
106	0.26
107	0.22
108	0.27
109	0.34
110	0.35
111	0.4
112	0.45
113	0.45
114	0.47
115	0.49
116	0.55
117	0.58
118	0.66
119	0.66
120	0.7
121	0.7
122	0.7
123	0.72
124	0.63
125	0.54
126	0.45
127	0.42
128	0.34
129	0.37
130	0.36
131	0.34
132	0.36
133	0.37
134	0.38
135	0.39
136	0.39
137	0.38
138	0.41
139	0.4
140	0.44
141	0.45
142	0.47
143	0.44
144	0.41
145	0.35
146	0.29
147	0.23
148	0.14
149	0.1
150	0.07
151	0.09
152	0.13
153	0.14
154	0.15
155	0.17
156	0.2
157	0.22
158	0.26
159	0.25
160	0.23
161	0.28
162	0.33
163	0.36
164	0.38
165	0.42
166	0.4
167	0.44
168	0.44
169	0.41
170	0.34
171	0.28
172	0.24
173	0.18
174	0.18
175	0.17
176	0.16
177	0.14
178	0.14
179	0.16
180	0.17
181	0.17
182	0.15
183	0.11
184	0.1
185	0.1
186	0.12
187	0.13
188	0.18
189	0.22
190	0.27
191	0.27
192	0.28
193	0.3
194	0.34
195	0.33
196	0.31
197	0.34
198	0.34
199	0.37
200	0.38
201	0.36
202	0.33
203	0.38
204	0.41
205	0.4
206	0.43
207	0.41
208	0.4
209	0.41
210	0.39
211	0.33
212	0.3
213	0.27
214	0.24
215	0.24
216	0.24
217	0.22
218	0.21
219	0.21
220	0.16
221	0.11
222	0.08
223	0.09
224	0.08
225	0.08
226	0.08
227	0.1
228	0.1
229	0.1
230	0.09
231	0.07
232	0.1
233	0.13
234	0.13
235	0.13
236	0.14
237	0.15
238	0.16
239	0.2
240	0.23
241	0.22
242	0.21
243	0.21
244	0.22
245	0.21
246	0.19
247	0.16
248	0.11
249	0.1
250	0.1
251	0.09
252	0.07
253	0.08
254	0.09
255	0.07
256	0.07
257	0.07
258	0.08
259	0.12
260	0.13
261	0.13
262	0.15
263	0.18
264	0.22
265	0.31
266	0.38
267	0.39
268	0.4
269	0.46
270	0.46
271	0.51
272	0.5
273	0.48
274	0.45
275	0.41
276	0.41
277	0.36
278	0.35
279	0.27
280	0.23
281	0.16
282	0.14
283	0.14
284	0.12
285	0.14
286	0.14
287	0.17
288	0.2
289	0.21
290	0.22
291	0.23
292	0.26
293	0.29
294	0.32
295	0.36
296	0.34
297	0.35
298	0.33
299	0.33
300	0.32
301	0.28
302	0.28
303	0.25
304	0.26
305	0.27
306	0.27
307	0.26
308	0.25
309	0.23
310	0.2
311	0.16
312	0.14
313	0.15
314	0.19
315	0.2
316	0.26
317	0.3
318	0.32
319	0.33
320	0.39
321	0.43
322	0.43
323	0.44
324	0.45
325	0.43
326	0.47
327	0.52
328	0.5
329	0.42
330	0.36
331	0.33
332	0.34
333	0.35
334	0.4
335	0.41
336	0.41
337	0.42
338	0.43
339	0.45
340	0.44
341	0.48
342	0.47
343	0.48
344	0.47
345	0.52
346	0.55
347	0.53
348	0.53
349	0.54
350	0.52
351	0.52
352	0.58
353	0.6
354	0.6
355	0.63
356	0.63
357	0.59
358	0.56
359	0.56
360	0.55
361	0.5
362	0.45
363	0.41
364	0.35
365	0.31
366	0.27
367	0.23
368	0.15
369	0.16
370	0.2
371	0.21
372	0.21
373	0.22
374	0.22
375	0.26
376	0.31
377	0.29
378	0.32
379	0.38
380	0.39
381	0.42
382	0.42
383	0.35
384	0.31
385	0.3
386	0.25
387	0.22
388	0.2
389	0.15
390	0.15
391	0.14
392	0.14
393	0.14
394	0.13
395	0.11
396	0.2
397	0.28
398	0.33
399	0.38
400	0.43
401	0.52
402	0.57
403	0.61
404	0.56
405	0.57
406	0.56
407	0.53
408	0.51
409	0.46
410	0.45
411	0.45
412	0.5
413	0.49
414	0.49
415	0.54
416	0.51
417	0.5
418	0.47
419	0.47
420	0.4
421	0.34
422	0.31
423	0.27
424	0.33
425	0.3
426	0.27
427	0.24
428	0.22
429	0.23
430	0.23
431	0.2
432	0.14
433	0.15
434	0.16
435	0.16
436	0.16
437	0.13
438	0.13
439	0.13
440	0.13
441	0.12
442	0.12
443	0.18
444	0.19
445	0.22
446	0.25
447	0.27
448	0.28
449	0.3
450	0.29

A0A0L6UFL5

3D AlphaFold-predicted Structure Viewer