Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0L6U5I0

Protein Details
Accession A0A0L6U5I0    Localization Confidence Low Confidence Score 7.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-20TPKGSKRKSPYLRLKKSLYGHydrophilic
NLS Segment(s)
Subcellular Location(s) mito_nucl 13.333, mito 13, nucl 11.5, cyto_nucl 7.666
Family & Domain DBs
InterPro View protein in InterPro  
IPR013103  RVT_2  
Pfam View protein in Pfam  
PF07727  RVT_2  
Amino Acid Sequences TPKGSKRKSPYLRLKKSLYGLKQAPENWFETLTSWLKDINFVQSTSDPCLFLHADGHSFVFFSCGRINCGRKGQNL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.76
3 0.74
4 0.71
5 0.63
6 0.6
7 0.53
8 0.49
9 0.48
10 0.45
11 0.4
12 0.34
13 0.33
14 0.25
15 0.23
16 0.2
17 0.17
18 0.19
19 0.17
20 0.15
21 0.14
22 0.14
23 0.13
24 0.15
25 0.14
26 0.14
27 0.14
28 0.13
29 0.15
30 0.15
31 0.17
32 0.19
33 0.2
34 0.15
35 0.14
36 0.17
37 0.16
38 0.14
39 0.15
40 0.12
41 0.12
42 0.12
43 0.13
44 0.1
45 0.1
46 0.09
47 0.1
48 0.1
49 0.11
50 0.16
51 0.16
52 0.21
53 0.29
54 0.33
55 0.36
56 0.46