Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L6V2R5

Protein Details
Accession A0A0L6V2R5    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
4-32LAHNYRKLYRSYRKTSRHPHPPVPRPINAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20, cyto_nucl 13.5, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR039196  Fmc1  
Gene Ontology GO:0005739  C:mitochondrion  
GO:0033615  P:mitochondrial proton-transporting ATP synthase complex assembly  
Pfam View protein in Pfam  
PF13233  Complex1_LYR_2  
Amino Acid Sequences MSSLAHNYRKLYRSYRKTSRHPHPPVPRPINAQIRSLISSGISDHQLQSLSQYLVASHLHQELVRRYNPADDLTEPERLKATVNRVGLNMPKELDLKNPLQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.66
2 0.73
3 0.74
4 0.81
5 0.85
6 0.85
7 0.86
8 0.84
9 0.84
10 0.84
11 0.85
12 0.86
13 0.82
14 0.75
15 0.7
16 0.71
17 0.7
18 0.61
19 0.54
20 0.45
21 0.41
22 0.39
23 0.33
24 0.24
25 0.15
26 0.13
27 0.12
28 0.11
29 0.1
30 0.09
31 0.09
32 0.1
33 0.1
34 0.09
35 0.09
36 0.1
37 0.09
38 0.09
39 0.08
40 0.07
41 0.09
42 0.09
43 0.09
44 0.08
45 0.08
46 0.08
47 0.09
48 0.12
49 0.15
50 0.19
51 0.19
52 0.2
53 0.2
54 0.22
55 0.23
56 0.22
57 0.2
58 0.17
59 0.21
60 0.22
61 0.29
62 0.26
63 0.26
64 0.25
65 0.22
66 0.24
67 0.23
68 0.28
69 0.27
70 0.3
71 0.3
72 0.3
73 0.33
74 0.35
75 0.33
76 0.29
77 0.23
78 0.23
79 0.24
80 0.24
81 0.26