Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0L6UUX0

Protein Details
Accession A0A0L6UUX0    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
23-51KASPKPTKTTTKKPAIRRKSKENRCNNSSHydrophilic
NLS Segment(s)
PositionSequence
25-43SPKPTKTTTKKPAIRRKSK
Subcellular Location(s) nucl 17.5, mito_nucl 13.166, cyto_nucl 10.833, mito 7.5
Family & Domain DBs
Amino Acid Sequences MPPRNKSNQKTSTSKNSSPMPTKASPKPTKTTTKKPAIRRKSKENRCNNSSSYYAAHKTEGHLKKEDYLVIIKWLKIKRNGDSCFGRGKAPAVGQYNHLL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.66
3 0.63
4 0.63
5 0.61
6 0.58
7 0.53
8 0.5
9 0.53
10 0.54
11 0.58
12 0.58
13 0.58
14 0.6
15 0.6
16 0.66
17 0.67
18 0.71
19 0.7
20 0.72
21 0.75
22 0.79
23 0.83
24 0.83
25 0.86
26 0.82
27 0.83
28 0.84
29 0.87
30 0.87
31 0.87
32 0.84
33 0.78
34 0.76
35 0.66
36 0.58
37 0.49
38 0.41
39 0.32
40 0.26
41 0.23
42 0.2
43 0.2
44 0.16
45 0.17
46 0.26
47 0.29
48 0.3
49 0.31
50 0.3
51 0.31
52 0.33
53 0.32
54 0.23
55 0.2
56 0.17
57 0.2
58 0.21
59 0.2
60 0.25
61 0.29
62 0.32
63 0.39
64 0.44
65 0.45
66 0.53
67 0.55
68 0.56
69 0.57
70 0.54
71 0.53
72 0.49
73 0.43
74 0.34
75 0.34
76 0.31
77 0.28
78 0.32
79 0.3
80 0.3