Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L6VVK0

Protein Details
Accession A0A0L6VVK0    Localization Confidence Medium Confidence Score 14.9
NoLS Segment(s)
PositionSequenceProtein Nature
9-28ASSGRAKCNGRKPCKGEWNTHydrophilic
135-165SEEEDKATKKRKRAPAKKKTKPNSPQPLDESHydrophilic
NLS Segment(s)
PositionSequence
141-156ATKKRKRAPAKKKTKP
Subcellular Location(s) nucl 16.5, cyto_nucl 10, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR001510  Znf_PARP  
IPR036957  Znf_PARP_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00645  zf-PARP  
PROSITE View protein in PROSITE  
PS50064  ZF_PARP_2  
Amino Acid Sequences MPGYRVEYASSGRAKCNGRKPCKGEWNTCLTQCQMDAGTSIGKGQLRFGTWVTLHEHGSFKWRHWGCLTSSASPSHVVLKNVSEELEGKISELDGLEELSVGDQSKIKKAFEEVHPDDVPPTAVPEKSAAEDAGSEEEDKATKKRKRAPAKKKTKPNSPQPLDESLSVDRPEEESEEKPAKKS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.45
3 0.53
4 0.57
5 0.6
6 0.68
7 0.72
8 0.75
9 0.8
10 0.8
11 0.78
12 0.73
13 0.73
14 0.67
15 0.63
16 0.55
17 0.45
18 0.39
19 0.31
20 0.27
21 0.18
22 0.14
23 0.13
24 0.12
25 0.11
26 0.1
27 0.1
28 0.11
29 0.12
30 0.12
31 0.13
32 0.15
33 0.15
34 0.17
35 0.17
36 0.18
37 0.17
38 0.19
39 0.2
40 0.2
41 0.2
42 0.2
43 0.21
44 0.17
45 0.24
46 0.22
47 0.2
48 0.27
49 0.27
50 0.27
51 0.28
52 0.3
53 0.26
54 0.34
55 0.36
56 0.29
57 0.3
58 0.28
59 0.27
60 0.25
61 0.23
62 0.2
63 0.2
64 0.18
65 0.17
66 0.17
67 0.18
68 0.17
69 0.17
70 0.11
71 0.09
72 0.1
73 0.1
74 0.09
75 0.08
76 0.07
77 0.07
78 0.07
79 0.06
80 0.05
81 0.03
82 0.04
83 0.03
84 0.03
85 0.03
86 0.03
87 0.04
88 0.04
89 0.04
90 0.06
91 0.07
92 0.12
93 0.15
94 0.15
95 0.15
96 0.18
97 0.22
98 0.25
99 0.34
100 0.31
101 0.35
102 0.36
103 0.35
104 0.33
105 0.28
106 0.24
107 0.14
108 0.15
109 0.11
110 0.11
111 0.11
112 0.13
113 0.13
114 0.14
115 0.15
116 0.12
117 0.1
118 0.1
119 0.1
120 0.1
121 0.1
122 0.09
123 0.08
124 0.09
125 0.1
126 0.11
127 0.16
128 0.24
129 0.28
130 0.36
131 0.46
132 0.56
133 0.66
134 0.76
135 0.82
136 0.84
137 0.9
138 0.92
139 0.94
140 0.92
141 0.92
142 0.9
143 0.9
144 0.9
145 0.85
146 0.82
147 0.76
148 0.72
149 0.64
150 0.56
151 0.49
152 0.4
153 0.38
154 0.31
155 0.27
156 0.22
157 0.21
158 0.21
159 0.21
160 0.22
161 0.2
162 0.27
163 0.35