Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L6UPG2

Protein Details
Accession A0A0L6UPG2   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MKMKLVPKKKKKVLIVGRHTPSHydrophilic
NLS Segment(s)
PositionSequence
8-12KKKKK
Subcellular Location(s) mito 22, mito_nucl 13.666, cyto_nucl 3.166
Family & Domain DBs
InterPro View protein in InterPro  
IPR013103  RVT_2  
Pfam View protein in Pfam  
PF07727  RVT_2  
Amino Acid Sequences MKMKLVPKKKKKVLIVGRHTPSSFLRTTWVFQTKHSTLSAPKQKRERLCIQGFSQVAGMDYRETFAPTGKVTSFLMLLTFAIDKNLSLKQFNVKSAFLYASLKEELYIKNPEGST
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.84
3 0.83
4 0.78
5 0.73
6 0.65
7 0.57
8 0.48
9 0.42
10 0.34
11 0.24
12 0.24
13 0.22
14 0.24
15 0.28
16 0.33
17 0.29
18 0.3
19 0.38
20 0.35
21 0.36
22 0.34
23 0.29
24 0.25
25 0.34
26 0.43
27 0.4
28 0.45
29 0.5
30 0.56
31 0.59
32 0.63
33 0.61
34 0.6
35 0.58
36 0.56
37 0.49
38 0.49
39 0.44
40 0.37
41 0.3
42 0.2
43 0.17
44 0.13
45 0.11
46 0.06
47 0.06
48 0.06
49 0.06
50 0.06
51 0.06
52 0.07
53 0.08
54 0.08
55 0.1
56 0.09
57 0.11
58 0.1
59 0.11
60 0.1
61 0.09
62 0.09
63 0.07
64 0.07
65 0.06
66 0.06
67 0.06
68 0.06
69 0.06
70 0.06
71 0.08
72 0.12
73 0.12
74 0.13
75 0.15
76 0.23
77 0.26
78 0.3
79 0.32
80 0.29
81 0.29
82 0.3
83 0.29
84 0.23
85 0.22
86 0.18
87 0.18
88 0.19
89 0.18
90 0.16
91 0.18
92 0.18
93 0.2
94 0.24
95 0.22