Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0L6V376

Protein Details
Accession A0A0L6V376    Localization Confidence High Confidence Score 16.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MDKRRKKKKRKDDDVNLSHLIBasic
NLS Segment(s)
PositionSequence
3-11KRRKKKKRK
Subcellular Location(s) nucl 23, mito 4
Family & Domain DBs
Amino Acid Sequences MDKRRKKKKRKDDDVNLSHLIKGQKELLDISCKKQKSFNDFANDMLISKDLTGMDEETFEYFRIKRHKAIPRAKSEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.9
2 0.85
3 0.77
4 0.66
5 0.55
6 0.48
7 0.38
8 0.27
9 0.24
10 0.2
11 0.17
12 0.18
13 0.19
14 0.17
15 0.23
16 0.24
17 0.26
18 0.3
19 0.3
20 0.29
21 0.34
22 0.37
23 0.37
24 0.42
25 0.42
26 0.43
27 0.42
28 0.42
29 0.39
30 0.34
31 0.25
32 0.19
33 0.14
34 0.08
35 0.07
36 0.08
37 0.06
38 0.06
39 0.07
40 0.08
41 0.08
42 0.08
43 0.09
44 0.09
45 0.1
46 0.1
47 0.11
48 0.11
49 0.17
50 0.25
51 0.28
52 0.33
53 0.42
54 0.52
55 0.6
56 0.7
57 0.74