Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0L6UII1

Protein Details
Accession A0A0L6UII1    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
59-84QVKIDDKGFNWRRKKREIKIFLLIRPHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20.5, cyto_nucl 11.5, mito 5
Family & Domain DBs
Amino Acid Sequences MNPLKEIPENPNQSPGKETPKNTSKGKRRASNYQNINPKRKAQVARDGLSFEMFKFEGQVKIDDKGFNWRRKKREIKIFLLIRPVL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.44
3 0.44
4 0.44
5 0.46
6 0.45
7 0.52
8 0.57
9 0.6
10 0.65
11 0.65
12 0.69
13 0.75
14 0.74
15 0.72
16 0.77
17 0.77
18 0.76
19 0.74
20 0.72
21 0.73
22 0.71
23 0.72
24 0.65
25 0.61
26 0.55
27 0.53
28 0.51
29 0.45
30 0.49
31 0.47
32 0.46
33 0.43
34 0.4
35 0.33
36 0.29
37 0.25
38 0.15
39 0.11
40 0.1
41 0.09
42 0.1
43 0.11
44 0.12
45 0.14
46 0.17
47 0.16
48 0.19
49 0.21
50 0.2
51 0.19
52 0.28
53 0.34
54 0.4
55 0.49
56 0.55
57 0.6
58 0.7
59 0.8
60 0.79
61 0.82
62 0.82
63 0.79
64 0.81
65 0.8
66 0.73