Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L6VAE8

Protein Details
Accession A0A0L6VAE8    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
155-179VSCGCSNGKRKSQNQQDPRQPQLHQHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22, cyto_nucl 15, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR005162  Retrotrans_gag_dom  
IPR001878  Znf_CCHC  
Gene Ontology GO:0003676  F:nucleic acid binding  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF03732  Retrotrans_gag  
PROSITE View protein in PROSITE  
PS50158  ZF_CCHC  
Amino Acid Sequences MKDDFKSSFFGHNHKHRAEVGLQSLRQTGTVSAYAQEFNSHTHTVGWANTPLMSLYQHGLKENIQLAMVMSKIQFNSLRNMQAMTLKAGQTIEGIQNGRTAPIPPASTSSPTTDPNAMDLSAFQCGGPHNQLSDAKRNCRLQLKLCFCCGQAGHVSCGCSNGKRKSQNQQDPRQPQLHQPFPNP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.56
3 0.5
4 0.51
5 0.47
6 0.43
7 0.41
8 0.4
9 0.39
10 0.37
11 0.37
12 0.33
13 0.29
14 0.25
15 0.18
16 0.14
17 0.15
18 0.14
19 0.14
20 0.15
21 0.15
22 0.14
23 0.15
24 0.13
25 0.13
26 0.17
27 0.17
28 0.16
29 0.16
30 0.17
31 0.16
32 0.17
33 0.17
34 0.13
35 0.13
36 0.13
37 0.13
38 0.11
39 0.11
40 0.1
41 0.09
42 0.09
43 0.12
44 0.12
45 0.13
46 0.14
47 0.14
48 0.16
49 0.17
50 0.16
51 0.13
52 0.12
53 0.11
54 0.11
55 0.1
56 0.07
57 0.06
58 0.07
59 0.07
60 0.09
61 0.11
62 0.12
63 0.16
64 0.18
65 0.2
66 0.19
67 0.19
68 0.18
69 0.18
70 0.18
71 0.15
72 0.15
73 0.13
74 0.13
75 0.13
76 0.12
77 0.1
78 0.1
79 0.08
80 0.08
81 0.09
82 0.08
83 0.1
84 0.1
85 0.1
86 0.09
87 0.1
88 0.09
89 0.11
90 0.12
91 0.11
92 0.14
93 0.15
94 0.17
95 0.18
96 0.2
97 0.2
98 0.2
99 0.22
100 0.21
101 0.2
102 0.18
103 0.18
104 0.14
105 0.12
106 0.11
107 0.1
108 0.09
109 0.09
110 0.07
111 0.07
112 0.08
113 0.11
114 0.13
115 0.12
116 0.12
117 0.15
118 0.2
119 0.23
120 0.32
121 0.35
122 0.38
123 0.44
124 0.47
125 0.49
126 0.52
127 0.53
128 0.52
129 0.57
130 0.61
131 0.57
132 0.57
133 0.54
134 0.46
135 0.46
136 0.37
137 0.3
138 0.29
139 0.27
140 0.28
141 0.28
142 0.29
143 0.24
144 0.28
145 0.27
146 0.25
147 0.32
148 0.37
149 0.44
150 0.52
151 0.58
152 0.66
153 0.75
154 0.8
155 0.82
156 0.84
157 0.86
158 0.84
159 0.85
160 0.8
161 0.71
162 0.7
163 0.7
164 0.69