Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L6UMF6

Protein Details
Accession A0A0L6UMF6   
Localization Confidence Medium
Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
60-88LNRTKFNLTKERKRNFKRLYLRRNNSTIMHydrophilic
NLS Segment(s)
PositionSequence
71-73RKR
Subcellular Location(s) nucl 17, cyto_nucl 10.5, mito 7
Family & Domain DBs
Amino Acid Sequences PLVPLAFDMDQLPSHNQAINSIQDMLKVFQLADTSKLRYIFLIQNLIEFSKSKLKHWRSLNRTKFNLTKERKRNFKRLYLRRNNSTIMEK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.19
3 0.18
4 0.19
5 0.21
6 0.2
7 0.2
8 0.19
9 0.18
10 0.17
11 0.18
12 0.16
13 0.14
14 0.13
15 0.11
16 0.09
17 0.11
18 0.1
19 0.13
20 0.14
21 0.15
22 0.17
23 0.18
24 0.17
25 0.16
26 0.19
27 0.18
28 0.17
29 0.19
30 0.17
31 0.17
32 0.17
33 0.17
34 0.14
35 0.12
36 0.12
37 0.16
38 0.16
39 0.2
40 0.29
41 0.34
42 0.41
43 0.5
44 0.59
45 0.6
46 0.7
47 0.77
48 0.76
49 0.74
50 0.72
51 0.69
52 0.65
53 0.67
54 0.64
55 0.65
56 0.66
57 0.72
58 0.77
59 0.8
60 0.84
61 0.81
62 0.82
63 0.83
64 0.84
65 0.86
66 0.86
67 0.88
68 0.85
69 0.82
70 0.75