Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L6UJ55

Protein Details
Accession A0A0L6UJ55    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
13-34TLTSLRNQRGRRRRDPAFRLWVHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 25
Family & Domain DBs
Amino Acid Sequences MSGSCLAVWTGWTLTSLRNQRGRRRRDPAFRLWVALSLKELALVSPMMAEELILVIRESAGLKADRNHVSFDVRLGEVEQAVEVMPGIHLDTVLCLLGYVQMGIGDFPVWAMIDSGLMVNLLPTDLV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.2
3 0.27
4 0.32
5 0.4
6 0.47
7 0.57
8 0.66
9 0.73
10 0.75
11 0.77
12 0.79
13 0.81
14 0.81
15 0.8
16 0.8
17 0.71
18 0.64
19 0.55
20 0.5
21 0.41
22 0.34
23 0.26
24 0.17
25 0.16
26 0.14
27 0.13
28 0.08
29 0.08
30 0.07
31 0.06
32 0.05
33 0.05
34 0.04
35 0.04
36 0.04
37 0.03
38 0.03
39 0.03
40 0.03
41 0.03
42 0.03
43 0.03
44 0.03
45 0.04
46 0.04
47 0.06
48 0.06
49 0.07
50 0.09
51 0.14
52 0.17
53 0.18
54 0.19
55 0.18
56 0.19
57 0.19
58 0.18
59 0.15
60 0.12
61 0.11
62 0.1
63 0.1
64 0.08
65 0.08
66 0.07
67 0.05
68 0.05
69 0.04
70 0.03
71 0.03
72 0.03
73 0.03
74 0.04
75 0.03
76 0.03
77 0.03
78 0.04
79 0.04
80 0.04
81 0.04
82 0.04
83 0.04
84 0.05
85 0.05
86 0.05
87 0.04
88 0.05
89 0.05
90 0.05
91 0.06
92 0.04
93 0.04
94 0.04
95 0.05
96 0.05
97 0.05
98 0.05
99 0.05
100 0.05
101 0.06
102 0.06
103 0.06
104 0.05
105 0.05
106 0.05
107 0.05