Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L6UUK1

Protein Details
Accession A0A0L6UUK1    Localization Confidence High Confidence Score 16
NoLS Segment(s)
PositionSequenceProtein Nature
50-78IDKIQSTSSKRRLRKWQKESRRFNKIRKVHydrophilic
NLS Segment(s)
PositionSequence
59-78KRRLRKWQKESRRFNKIRKV
Subcellular Location(s) nucl 20, cyto 5
Family & Domain DBs
Amino Acid Sequences IKFSEDGYCKPTALSDLLEFTEREIKAASDDIFGYGRAFVESNRVMQQGIDKIQSTSSKRRLRKWQKESRRFNKIRKV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.14
3 0.15
4 0.16
5 0.17
6 0.16
7 0.15
8 0.2
9 0.18
10 0.17
11 0.16
12 0.15
13 0.15
14 0.17
15 0.16
16 0.1
17 0.1
18 0.11
19 0.1
20 0.1
21 0.09
22 0.07
23 0.07
24 0.06
25 0.06
26 0.05
27 0.1
28 0.1
29 0.12
30 0.13
31 0.13
32 0.13
33 0.13
34 0.16
35 0.14
36 0.16
37 0.16
38 0.15
39 0.15
40 0.18
41 0.23
42 0.26
43 0.31
44 0.4
45 0.47
46 0.52
47 0.61
48 0.7
49 0.76
50 0.82
51 0.84
52 0.85
53 0.88
54 0.93
55 0.95
56 0.94
57 0.94
58 0.91