Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L6URG2

Protein Details
Accession A0A0L6URG2    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
38-59ISKITRGSFKSKHRRASKVFEEHydrophilic
240-287RKMLKAYPKKLKRILMKSKINLMELAKKKLPQLKPRKILKKILMKTTTHydrophilic
NLS Segment(s)
PositionSequence
244-280KAYPKKLKRILMKSKINLMELAKKKLPQLKPRKILKK
Subcellular Location(s) nucl 18, mito_nucl 13.333, cyto_nucl 10.333, mito 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR012337  RNaseH-like_sf  
IPR036397  RNaseH_sf  
Gene Ontology GO:0003676  F:nucleic acid binding  
Amino Acid Sequences MTSAELLHKSLGHVSYSRLRKNLGIPLKIEKTCESCAISKITRGSFKSKHRRASKVFEEVHLDLMGPIWPPSRNGHRYILTFLDSRSRFCSAIPLKHKSNVFQQLTYMIDIEAKRQNGLAERFNRTIIESLRSILHDSGMNSRLWNELARVSSLTINQIPSHKSKKSPFEVFKNQILPLSYFHPIGNRVSYLILPEHPHSKIKPKGSLGHLIGYKDELQSLHILAEDGKIIETKHIDFLRKMLKAYPKKLKRILMKSKINLMELAKKKLPQLKPRKILKKILMKTTTRWLSHILQEWHEIQQQRKMDNCCR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.31
3 0.39
4 0.43
5 0.41
6 0.41
7 0.43
8 0.48
9 0.53
10 0.52
11 0.48
12 0.45
13 0.51
14 0.56
15 0.53
16 0.5
17 0.44
18 0.41
19 0.39
20 0.4
21 0.35
22 0.3
23 0.32
24 0.35
25 0.33
26 0.32
27 0.35
28 0.36
29 0.39
30 0.4
31 0.46
32 0.48
33 0.57
34 0.64
35 0.67
36 0.72
37 0.74
38 0.8
39 0.79
40 0.81
41 0.78
42 0.76
43 0.7
44 0.62
45 0.6
46 0.51
47 0.46
48 0.36
49 0.28
50 0.18
51 0.17
52 0.15
53 0.09
54 0.09
55 0.09
56 0.1
57 0.12
58 0.17
59 0.26
60 0.29
61 0.34
62 0.39
63 0.41
64 0.42
65 0.43
66 0.4
67 0.33
68 0.3
69 0.26
70 0.29
71 0.26
72 0.26
73 0.26
74 0.26
75 0.24
76 0.23
77 0.32
78 0.29
79 0.37
80 0.43
81 0.45
82 0.45
83 0.5
84 0.52
85 0.45
86 0.48
87 0.49
88 0.44
89 0.38
90 0.36
91 0.33
92 0.33
93 0.31
94 0.22
95 0.12
96 0.13
97 0.12
98 0.15
99 0.17
100 0.16
101 0.16
102 0.16
103 0.17
104 0.19
105 0.23
106 0.26
107 0.26
108 0.31
109 0.32
110 0.32
111 0.31
112 0.27
113 0.27
114 0.21
115 0.2
116 0.15
117 0.15
118 0.15
119 0.15
120 0.16
121 0.12
122 0.12
123 0.1
124 0.11
125 0.14
126 0.15
127 0.15
128 0.13
129 0.14
130 0.14
131 0.13
132 0.12
133 0.09
134 0.09
135 0.1
136 0.11
137 0.1
138 0.1
139 0.11
140 0.11
141 0.12
142 0.1
143 0.11
144 0.11
145 0.13
146 0.14
147 0.18
148 0.23
149 0.23
150 0.28
151 0.33
152 0.4
153 0.45
154 0.51
155 0.52
156 0.55
157 0.62
158 0.61
159 0.59
160 0.53
161 0.47
162 0.39
163 0.35
164 0.27
165 0.2
166 0.19
167 0.16
168 0.15
169 0.14
170 0.15
171 0.15
172 0.16
173 0.15
174 0.13
175 0.12
176 0.12
177 0.12
178 0.11
179 0.11
180 0.11
181 0.12
182 0.13
183 0.16
184 0.17
185 0.2
186 0.2
187 0.28
188 0.33
189 0.37
190 0.41
191 0.42
192 0.47
193 0.48
194 0.54
195 0.46
196 0.45
197 0.41
198 0.35
199 0.31
200 0.27
201 0.24
202 0.16
203 0.16
204 0.11
205 0.1
206 0.11
207 0.11
208 0.09
209 0.08
210 0.08
211 0.08
212 0.08
213 0.07
214 0.06
215 0.06
216 0.07
217 0.07
218 0.09
219 0.11
220 0.11
221 0.18
222 0.2
223 0.23
224 0.22
225 0.28
226 0.33
227 0.33
228 0.33
229 0.32
230 0.4
231 0.46
232 0.55
233 0.6
234 0.61
235 0.68
236 0.74
237 0.77
238 0.76
239 0.79
240 0.81
241 0.8
242 0.81
243 0.76
244 0.77
245 0.72
246 0.63
247 0.56
248 0.48
249 0.48
250 0.44
251 0.47
252 0.41
253 0.4
254 0.45
255 0.51
256 0.56
257 0.57
258 0.63
259 0.67
260 0.74
261 0.82
262 0.87
263 0.86
264 0.87
265 0.85
266 0.85
267 0.81
268 0.81
269 0.79
270 0.72
271 0.68
272 0.69
273 0.68
274 0.58
275 0.53
276 0.48
277 0.44
278 0.47
279 0.52
280 0.45
281 0.4
282 0.43
283 0.43
284 0.42
285 0.43
286 0.41
287 0.36
288 0.4
289 0.43
290 0.44
291 0.49