Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L6VUP0

Protein Details
Accession A0A0L6VUP0    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MINLDHKIKRKEKPQRLIYEVHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 11cyto_nucl 11, cyto 9, mito 6
Family & Domain DBs
Amino Acid Sequences MINLDHKIKRKEKPQRLIYEVHGKVSYMKELRELGLDFEEIKKIVDKEFPSITNPLHSSESDLSSSSVDKEI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.82
3 0.79
4 0.75
5 0.7
6 0.69
7 0.59
8 0.51
9 0.41
10 0.33
11 0.31
12 0.28
13 0.28
14 0.19
15 0.19
16 0.18
17 0.19
18 0.19
19 0.18
20 0.17
21 0.13
22 0.12
23 0.12
24 0.09
25 0.09
26 0.09
27 0.07
28 0.08
29 0.09
30 0.09
31 0.1
32 0.14
33 0.15
34 0.19
35 0.21
36 0.22
37 0.23
38 0.25
39 0.24
40 0.24
41 0.24
42 0.23
43 0.23
44 0.22
45 0.25
46 0.25
47 0.26
48 0.23
49 0.22
50 0.2
51 0.19
52 0.2