Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L6UHV1

Protein Details
Accession A0A0L6UHV1   
Localization Confidence Medium
Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-41MTQPSSTPAPRPKKKSKKKAMMGPRRRRQWKKRIKLSLTGSHydrophilic
NLS Segment(s)
PositionSequence
10-35PRPKKKSKKKAMMGPRRRRQWKKRIK
Subcellular Location(s) nucl 15, mito_nucl 13.666, mito 10, cyto_nucl 9.666
Family & Domain DBs
Amino Acid Sequences MTQPSSTPAPRPKKKSKKKAMMGPRRRRQWKKRIKLSLTGSLMAPTSYNEVLQLMINNGINHCDVNGITQKINDLHLSYKTSRNWKRNTRAGILGSNMVNGVKTVKGN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.9
3 0.92
4 0.92
5 0.92
6 0.93
7 0.92
8 0.93
9 0.92
10 0.92
11 0.91
12 0.9
13 0.91
14 0.92
15 0.91
16 0.91
17 0.91
18 0.9
19 0.91
20 0.92
21 0.86
22 0.84
23 0.79
24 0.77
25 0.68
26 0.57
27 0.47
28 0.37
29 0.32
30 0.23
31 0.17
32 0.09
33 0.09
34 0.08
35 0.08
36 0.07
37 0.07
38 0.08
39 0.08
40 0.07
41 0.05
42 0.06
43 0.07
44 0.07
45 0.07
46 0.08
47 0.08
48 0.07
49 0.07
50 0.06
51 0.05
52 0.08
53 0.12
54 0.12
55 0.12
56 0.12
57 0.14
58 0.14
59 0.16
60 0.14
61 0.12
62 0.13
63 0.15
64 0.19
65 0.2
66 0.26
67 0.3
68 0.4
69 0.47
70 0.54
71 0.61
72 0.67
73 0.74
74 0.77
75 0.78
76 0.73
77 0.7
78 0.64
79 0.58
80 0.5
81 0.45
82 0.36
83 0.3
84 0.25
85 0.19
86 0.15
87 0.12
88 0.11