Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L6VUX2

Protein Details
Accession A0A0L6VUX2   
Localization Confidence Medium
Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
364-389LTELKKMGSQKPAKRQARPTRDQAASHydrophilic
NLS Segment(s)
PositionSequence
374-378KPAKR
Subcellular Location(s) nucl 10, mito 10, mito_nucl 10
Family & Domain DBs
InterPro View protein in InterPro  
IPR006597  Sel1-like  
IPR011990  TPR-like_helical_dom_sf  
Pfam View protein in Pfam  
PF08238  Sel1  
Amino Acid Sequences MLLAPHNPILHHPPPSRSPALLPPKTGPTISKASIDEYRNRIKSDPDPEAHFNYAKFLIEAARKLASGGAAGDDKAIKKYRDALLQESLKLIKKLATQGVGLGKPPYSDAQFFLANCLGNGSLGLGVDHEKAYNLYVQASKQNHPAATYRTAVCNELGAGTRKDSQRAVLFYRKASALGDTAGMYKLGMILLGGLLGQPKNPQEALLWLKRAAQQADEDNPHALHELAQIYEKPPLVTVGPTPTPNGKHANSTSGASTPQISYLVQRDEASIGWYTKAAERGDAESELALSGWYLTGSEGVLRQSDSEAYLWARRAASKGLPKAEYAVGYYAEVGIGVKQDIEEAKRWYMRAATNKNKRAMQRLTELKKMGSQKPAKRQARPTRDQAASECVIV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.56
3 0.55
4 0.48
5 0.47
6 0.48
7 0.55
8 0.53
9 0.52
10 0.48
11 0.5
12 0.51
13 0.48
14 0.4
15 0.35
16 0.38
17 0.36
18 0.36
19 0.31
20 0.33
21 0.39
22 0.41
23 0.43
24 0.43
25 0.51
26 0.5
27 0.51
28 0.48
29 0.47
30 0.51
31 0.51
32 0.53
33 0.46
34 0.5
35 0.52
36 0.55
37 0.53
38 0.47
39 0.39
40 0.34
41 0.32
42 0.26
43 0.21
44 0.17
45 0.19
46 0.21
47 0.22
48 0.21
49 0.2
50 0.2
51 0.2
52 0.2
53 0.15
54 0.12
55 0.11
56 0.1
57 0.09
58 0.1
59 0.1
60 0.12
61 0.12
62 0.17
63 0.22
64 0.2
65 0.21
66 0.28
67 0.32
68 0.38
69 0.4
70 0.4
71 0.43
72 0.45
73 0.44
74 0.39
75 0.37
76 0.32
77 0.3
78 0.26
79 0.21
80 0.21
81 0.26
82 0.28
83 0.26
84 0.24
85 0.27
86 0.31
87 0.28
88 0.26
89 0.22
90 0.18
91 0.16
92 0.18
93 0.17
94 0.14
95 0.14
96 0.15
97 0.17
98 0.19
99 0.19
100 0.2
101 0.19
102 0.17
103 0.15
104 0.14
105 0.11
106 0.09
107 0.09
108 0.07
109 0.05
110 0.05
111 0.05
112 0.05
113 0.06
114 0.07
115 0.07
116 0.07
117 0.07
118 0.07
119 0.08
120 0.1
121 0.09
122 0.1
123 0.11
124 0.12
125 0.19
126 0.22
127 0.23
128 0.27
129 0.3
130 0.28
131 0.29
132 0.3
133 0.28
134 0.28
135 0.29
136 0.24
137 0.24
138 0.24
139 0.23
140 0.2
141 0.16
142 0.13
143 0.11
144 0.12
145 0.12
146 0.12
147 0.13
148 0.18
149 0.18
150 0.2
151 0.19
152 0.21
153 0.22
154 0.24
155 0.27
156 0.29
157 0.3
158 0.29
159 0.3
160 0.27
161 0.24
162 0.21
163 0.17
164 0.11
165 0.09
166 0.09
167 0.08
168 0.08
169 0.08
170 0.07
171 0.06
172 0.05
173 0.05
174 0.04
175 0.03
176 0.03
177 0.02
178 0.02
179 0.02
180 0.02
181 0.02
182 0.03
183 0.03
184 0.04
185 0.05
186 0.06
187 0.08
188 0.08
189 0.08
190 0.08
191 0.13
192 0.18
193 0.19
194 0.2
195 0.19
196 0.21
197 0.24
198 0.27
199 0.22
200 0.18
201 0.18
202 0.2
203 0.23
204 0.23
205 0.2
206 0.18
207 0.17
208 0.16
209 0.14
210 0.11
211 0.08
212 0.09
213 0.08
214 0.08
215 0.09
216 0.09
217 0.1
218 0.12
219 0.12
220 0.1
221 0.1
222 0.1
223 0.1
224 0.1
225 0.11
226 0.12
227 0.14
228 0.14
229 0.16
230 0.18
231 0.2
232 0.22
233 0.26
234 0.23
235 0.27
236 0.27
237 0.3
238 0.27
239 0.26
240 0.24
241 0.2
242 0.19
243 0.14
244 0.15
245 0.11
246 0.1
247 0.1
248 0.09
249 0.11
250 0.14
251 0.15
252 0.15
253 0.15
254 0.15
255 0.15
256 0.15
257 0.15
258 0.13
259 0.12
260 0.11
261 0.11
262 0.11
263 0.13
264 0.17
265 0.16
266 0.15
267 0.17
268 0.18
269 0.2
270 0.2
271 0.18
272 0.13
273 0.13
274 0.11
275 0.09
276 0.06
277 0.04
278 0.04
279 0.04
280 0.04
281 0.04
282 0.04
283 0.04
284 0.04
285 0.05
286 0.07
287 0.07
288 0.08
289 0.08
290 0.09
291 0.09
292 0.1
293 0.11
294 0.1
295 0.11
296 0.12
297 0.15
298 0.16
299 0.18
300 0.18
301 0.18
302 0.2
303 0.22
304 0.27
305 0.33
306 0.38
307 0.41
308 0.41
309 0.4
310 0.41
311 0.39
312 0.33
313 0.26
314 0.22
315 0.16
316 0.16
317 0.15
318 0.12
319 0.1
320 0.09
321 0.07
322 0.06
323 0.06
324 0.06
325 0.06
326 0.06
327 0.08
328 0.11
329 0.14
330 0.17
331 0.2
332 0.26
333 0.29
334 0.29
335 0.3
336 0.32
337 0.37
338 0.43
339 0.5
340 0.55
341 0.63
342 0.7
343 0.75
344 0.75
345 0.73
346 0.72
347 0.7
348 0.65
349 0.65
350 0.68
351 0.67
352 0.68
353 0.65
354 0.57
355 0.56
356 0.57
357 0.54
358 0.53
359 0.57
360 0.59
361 0.68
362 0.77
363 0.79
364 0.81
365 0.85
366 0.86
367 0.87
368 0.86
369 0.83
370 0.82
371 0.78
372 0.72
373 0.65
374 0.61