Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L6UVZ2

Protein Details
Accession A0A0L6UVZ2   
Localization Confidence Medium
Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
8-36WWKPIRRKAAGKSKKSYQKTPKGKPNMEAHydrophilic
NLS Segment(s)
PositionSequence
10-31KPIRRKAAGKSKKSYQKTPKGK
Subcellular Location(s) mito 15, nucl 9.5, cyto_nucl 6.5
Family & Domain DBs
Amino Acid Sequences MSVDGVAWWKPIRRKAAGKSKKSYQKTPKGKPNMEATSSALPHSLTVGKPVTIRLVTDTYSPEHPDQPNRLTREFETAYYSDLIPDLYKPSSTTFTYSQSHFYVATANTLVVYKKDIRFPRDLQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.61
3 0.7
4 0.75
5 0.77
6 0.77
7 0.8
8 0.82
9 0.8
10 0.8
11 0.79
12 0.8
13 0.82
14 0.84
15 0.85
16 0.85
17 0.82
18 0.77
19 0.75
20 0.69
21 0.61
22 0.53
23 0.46
24 0.4
25 0.37
26 0.32
27 0.23
28 0.17
29 0.15
30 0.15
31 0.13
32 0.09
33 0.12
34 0.12
35 0.13
36 0.13
37 0.13
38 0.14
39 0.12
40 0.13
41 0.12
42 0.12
43 0.12
44 0.13
45 0.14
46 0.13
47 0.14
48 0.16
49 0.14
50 0.17
51 0.18
52 0.21
53 0.24
54 0.27
55 0.32
56 0.33
57 0.34
58 0.32
59 0.31
60 0.34
61 0.31
62 0.27
63 0.25
64 0.22
65 0.22
66 0.2
67 0.19
68 0.13
69 0.11
70 0.11
71 0.07
72 0.08
73 0.09
74 0.09
75 0.09
76 0.1
77 0.13
78 0.16
79 0.17
80 0.21
81 0.2
82 0.25
83 0.27
84 0.27
85 0.29
86 0.26
87 0.26
88 0.22
89 0.2
90 0.2
91 0.17
92 0.18
93 0.15
94 0.14
95 0.13
96 0.14
97 0.15
98 0.11
99 0.15
100 0.19
101 0.22
102 0.31
103 0.38
104 0.42