Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0L6V4Z4

Protein Details
Accession A0A0L6V4Z4    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-25MPKKATPMPKKATPKPTKQNTKMPAHydrophilic
NLS Segment(s)
PositionSequence
9-18PKKATPKPTK
Subcellular Location(s) nucl 15, mito 11
Family & Domain DBs
Amino Acid Sequences MPKKATPMPKKATPKPTKQNTKMPAIHGKTKKNIVKINGFDMMAIKLQNQSTSKINLNPYQMKDQFNTYKDKYKKISSKN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.82
3 0.85
4 0.87
5 0.84
6 0.85
7 0.79
8 0.8
9 0.72
10 0.67
11 0.66
12 0.59
13 0.62
14 0.58
15 0.58
16 0.54
17 0.59
18 0.57
19 0.54
20 0.54
21 0.5
22 0.5
23 0.47
24 0.45
25 0.38
26 0.34
27 0.28
28 0.24
29 0.2
30 0.13
31 0.11
32 0.08
33 0.09
34 0.09
35 0.13
36 0.13
37 0.15
38 0.17
39 0.2
40 0.23
41 0.25
42 0.29
43 0.29
44 0.35
45 0.38
46 0.39
47 0.45
48 0.46
49 0.45
50 0.42
51 0.46
52 0.46
53 0.43
54 0.47
55 0.42
56 0.49
57 0.5
58 0.57
59 0.55
60 0.59