Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L6VFB4

Protein Details
Accession A0A0L6VFB4    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
104-132AEKQNQTEQKKVNKKKQDEKRRLEQGKEGHydrophilic
NLS Segment(s)
PositionSequence
114-127KVNKKKQDEKRRLE
Subcellular Location(s) mito 10, cyto 8, nucl 7
Family & Domain DBs
Amino Acid Sequences MAVVTKERRLLQLAKIEIHDIHGNPPPRAPSSPAHLLACLPEKFDGTCGPATQAFLQQTGLYCLAHPDKFPDNGSKIIFMLTNLSGNTAKWDQMLNQQNPDKIAEKQNQTEQKKVNKKKQDEKRRLEQGKEGYHKDKS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.38
3 0.37
4 0.32
5 0.32
6 0.29
7 0.22
8 0.22
9 0.26
10 0.28
11 0.27
12 0.29
13 0.28
14 0.28
15 0.3
16 0.3
17 0.27
18 0.3
19 0.37
20 0.37
21 0.35
22 0.31
23 0.3
24 0.28
25 0.31
26 0.24
27 0.18
28 0.16
29 0.16
30 0.16
31 0.17
32 0.15
33 0.12
34 0.13
35 0.12
36 0.13
37 0.13
38 0.14
39 0.14
40 0.16
41 0.13
42 0.13
43 0.13
44 0.12
45 0.12
46 0.13
47 0.12
48 0.09
49 0.08
50 0.1
51 0.12
52 0.12
53 0.12
54 0.13
55 0.15
56 0.16
57 0.18
58 0.19
59 0.19
60 0.21
61 0.22
62 0.19
63 0.16
64 0.16
65 0.14
66 0.11
67 0.11
68 0.08
69 0.09
70 0.08
71 0.1
72 0.1
73 0.1
74 0.14
75 0.12
76 0.12
77 0.12
78 0.12
79 0.12
80 0.21
81 0.3
82 0.28
83 0.34
84 0.37
85 0.37
86 0.38
87 0.39
88 0.33
89 0.27
90 0.33
91 0.33
92 0.36
93 0.39
94 0.47
95 0.54
96 0.55
97 0.59
98 0.58
99 0.61
100 0.67
101 0.73
102 0.75
103 0.75
104 0.81
105 0.85
106 0.89
107 0.9
108 0.9
109 0.88
110 0.89
111 0.89
112 0.86
113 0.8
114 0.78
115 0.75
116 0.74
117 0.73
118 0.69