Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0L6VJH5

Protein Details
Accession A0A0L6VJH5    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
8-41KNATLMPKKTTPKPKKTNTKKPSKEIPRKAEKNEHydrophilic
NLS Segment(s)
PositionSequence
15-40KKTTPKPKKTNTKKPSKEIPRKAEKN
Subcellular Location(s) mito 14, mito_nucl 13.5, nucl 11
Family & Domain DBs
Amino Acid Sequences MRKTSTFKNATLMPKKTTPKPKKTNTKKPSKEIPRKAEKNEKLVIIKWLNIKQNYNSCFGTGKAPSVGHPAKAQINGFDMMTINL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.58
3 0.62
4 0.67
5 0.67
6 0.69
7 0.75
8 0.81
9 0.85
10 0.9
11 0.92
12 0.91
13 0.92
14 0.89
15 0.86
16 0.86
17 0.86
18 0.86
19 0.84
20 0.83
21 0.83
22 0.81
23 0.8
24 0.8
25 0.72
26 0.67
27 0.6
28 0.53
29 0.44
30 0.39
31 0.38
32 0.28
33 0.27
34 0.26
35 0.28
36 0.3
37 0.31
38 0.33
39 0.32
40 0.38
41 0.38
42 0.37
43 0.33
44 0.29
45 0.28
46 0.26
47 0.27
48 0.2
49 0.2
50 0.18
51 0.18
52 0.18
53 0.26
54 0.27
55 0.24
56 0.24
57 0.26
58 0.27
59 0.31
60 0.3
61 0.23
62 0.25
63 0.24
64 0.23
65 0.2