Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L6VEC5

Protein Details
Accession A0A0L6VEC5   
Localization Confidence Medium
Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
1-50MNFLKSLINHRKKRHPKTLQKEKEGHKTVRTSTPRAKPHQRKLQIRSNNTHydrophilic
NLS Segment(s)
PositionSequence
10-42HRKKRHPKTLQKEKEGHKTVRTSTPRAKPHQRK
Subcellular Location(s) nucl 20, mito_nucl 13.333, cyto_nucl 11.333, mito 5.5
Family & Domain DBs
Amino Acid Sequences MNFLKSLINHRKKRHPKTLQKEKEGHKTVRTSTPRAKPHQRKLQIRSNNTGSMPPSEMKFKNNDKGVELEEKKFNHSVTLEEEKWDHGIKLWKISLTEKEEKEKDRSFEMAHLKQLAPQEHIGIKV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.87
3 0.88
4 0.9
5 0.94
6 0.93
7 0.91
8 0.89
9 0.85
10 0.85
11 0.81
12 0.74
13 0.68
14 0.63
15 0.58
16 0.6
17 0.58
18 0.54
19 0.55
20 0.6
21 0.62
22 0.66
23 0.73
24 0.73
25 0.78
26 0.82
27 0.83
28 0.83
29 0.82
30 0.84
31 0.81
32 0.76
33 0.72
34 0.65
35 0.58
36 0.49
37 0.44
38 0.35
39 0.28
40 0.25
41 0.19
42 0.16
43 0.19
44 0.19
45 0.19
46 0.24
47 0.26
48 0.31
49 0.34
50 0.33
51 0.29
52 0.3
53 0.31
54 0.33
55 0.3
56 0.27
57 0.27
58 0.27
59 0.29
60 0.28
61 0.26
62 0.2
63 0.18
64 0.18
65 0.19
66 0.25
67 0.23
68 0.22
69 0.23
70 0.21
71 0.22
72 0.21
73 0.15
74 0.12
75 0.2
76 0.2
77 0.25
78 0.26
79 0.25
80 0.26
81 0.3
82 0.33
83 0.33
84 0.4
85 0.37
86 0.43
87 0.47
88 0.5
89 0.54
90 0.52
91 0.47
92 0.43
93 0.44
94 0.38
95 0.4
96 0.45
97 0.41
98 0.4
99 0.4
100 0.37
101 0.37
102 0.42
103 0.37
104 0.32
105 0.3
106 0.3