Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L6VKM0

Protein Details
Accession A0A0L6VKM0   
Localization Confidence Medium
Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
1-34MPKKASPKPTKPTTKKPAIRRKSKKNRGNNSSEDHydrophilic
NLS Segment(s)
PositionSequence
3-27KKASPKPTKPTTKKPAIRRKSKKNR
Subcellular Location(s) nucl 20.5, mito_nucl 13.833, cyto_nucl 11.666, mito 5
Family & Domain DBs
Amino Acid Sequences MPKKASPKPTKPTTKKPAIRRKSKKNRGNNSSEDDASDKTAGHLKKDNNLVIIKWLKIEQNYNSCFGTGVIQQKLKSMALR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.85
3 0.87
4 0.87
5 0.86
6 0.89
7 0.88
8 0.9
9 0.9
10 0.93
11 0.92
12 0.91
13 0.92
14 0.89
15 0.86
16 0.79
17 0.74
18 0.67
19 0.58
20 0.48
21 0.38
22 0.31
23 0.24
24 0.19
25 0.13
26 0.1
27 0.15
28 0.14
29 0.14
30 0.19
31 0.19
32 0.24
33 0.29
34 0.29
35 0.27
36 0.28
37 0.26
38 0.27
39 0.28
40 0.23
41 0.19
42 0.2
43 0.19
44 0.21
45 0.26
46 0.25
47 0.31
48 0.33
49 0.34
50 0.33
51 0.31
52 0.29
53 0.24
54 0.21
55 0.18
56 0.22
57 0.25
58 0.28
59 0.29
60 0.31
61 0.34